KEGG   Azospirillum brasilense Sp245: AZOBR_p1130006Help
Entry
AZOBR_p1130006    CDS       T02152                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_p1130006
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p1130006
   00620 Pyruvate metabolism
    AZOBR_p1130006
   00640 Propanoate metabolism
    AZOBR_p1130006
  Energy metabolism
   00680 Methane metabolism
    AZOBR_p1130006
Enzymes [BR:abs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZOBR_p1130006
Lipid biosynthesis proteins [BR:abs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZOBR_p1130006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:1206866..1208482
Genome map
AA seq 538 aa AA seqDB search
MLPEADSYEGLRDRFVWSVPERYNIGVDVCDKWAERDPDRTALIHKRRDGAVETHSFADI
RRLSNRLANALAAHGVARGDRVGILLPQAPETAVSHVAVYKMGGVAVPLFSLFGVEALEY
RLGNCGARAVVTDAVGAAKIAQIRDRLPELKLVLRIDEAGEGELDWHALVDAASEDFTPV
DTAADDPAVIIYTSGTTGQPKGALHAHRVLLGHLPGVEISHDLFPQPGDRIWTPADWAWI
GGLLDVLMPAWHHGVTVVSHRFEKFDAEEAFRLIADFQVRNAFLPPTALKMMRAVKDPQT
RWNYSMRSVASGGETLGAELLDWGRQTFGLTINEFYGQTECNMIVSSCATVMPPKPGVMG
RPAPGHDVAVIDGQGNRLPPGEIGLIAVHRPDPVMFLQYWNNPEATAAKFVGDWLVTGDQ
GELDTDGYIRFVGRDDDVITSAGYRIGPGEIEDCLIGHPAVRMAAVVGVPNPLRTEIVKA
FIVLQDGVRPSDALAAEIQAHVKTRLAAHEYPRAVEFVDSLPMTTTGKIIRRELRGRG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggaagcggacagctacgagggcctgcgcgaccgtttcgtctggtcggtgccg
gagcgttacaacatcggcgtggacgtctgcgacaagtgggcggagcgcgatccggaccgc
accgccctgatccacaagcgccgggacggcgcggtggagacccacagcttcgccgacatc
cgccgcctgtcgaaccgcctcgccaacgcgctggccgcccatggggtggcgcgcggcgac
cgggtgggcatcctgctgccccaggcgccggagaccgcggtcagccacgtcgccgtctac
aagatgggcggcgtcgccgttcccctcttctcgctgttcggcgttgaagcgctggagtac
cggctcggcaattgcggggcgcgggcggtggtgaccgacgccgtgggtgcggccaagatc
gcccagatccgcgaccgcctgcccgagctgaaactcgtcctgcgcatcgacgaggccgga
gagggcgagctggactggcacgcgctggtcgatgcggcgtcggaggacttcacgccggtg
gacacggcggcggacgacccggcggtgatcatctacacctccggcaccaccggccagccc
aagggcgcgctgcacgcgcaccgggtgctgctcggccacctgccgggggtggagatttcc
cacgacctgttcccgcagccgggcgaccgcatctggaccccggcggactgggcgtggatc
ggcggtttgctcgacgtgctgatgcccgcctggcaccatggcgtgaccgtggtctcccac
cgcttcgagaagttcgacgcggaggaggccttccgcctgatcgccgatttccaggtgcgc
aacgccttcctgccgccgaccgcgctgaagatgatgcgcgcggtgaaggacccgcagacg
cgctggaattacagcatgcgctccgtcgccagcggcggcgagacgctgggggccgagctt
ctcgattggggccgccagaccttcgggctgaccatcaacgagttctacggccagaccgag
tgcaacatgatcgtgtcctcctgcgccacggtcatgccgcccaagcccggcgtcatgggc
cgcccggcgcccggccacgacgtggcggtgatcgacgggcagggcaaccgccttcctccc
ggtgagatcggcctgatcgccgtgcaccgcccggacccggtgatgttcctgcaatactgg
aacaacccggaggccaccgccgcgaagtttgtcggcgactggctggtcaccggcgaccag
ggcgagttggacaccgacggctacatccgcttcgtcgggcgggacgacgacgtgatcacg
tcggccggctaccgcatcggccccggcgagatcgaggattgcctgatcggccaccccgcc
gtccgcatggccgccgtggtcggcgtgccgaaccctctgcgcaccgagatcgtgaaggcc
ttcatcgtcctccaggacggcgttcgccccagcgacgcactggcggcggagatccaggcc
catgtgaagacgcggctggccgcccacgagtatccccgcgcggttgagttcgtggacagc
ctgccgatgacgaccacgggcaagatcatccggcgcgagctgcgggggcgggggtaa

DBGET integrated database retrieval system