KEGG   Azospirillum brasilense: AZOBR_p120114Help
Entry
AZOBR_p120114     CDS       T02152                                 

Definition
beta-N-acetylhexosaminidase (fragment)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abs  Azospirillum brasilense
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZOBR_p120114
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AZOBR_p120114
Enzymes [BR:abs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AZOBR_p120114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(237203..237973)
Genome map
AA seq 256 aa AA seqDB search
MRAFGDLAARDAAAGREAARINARLLAQMLADCGVTVDCAPVCDVPVEGAHDIIGDRAFC
GDPARVADLARATCEGLMAGGVLPVVKHLPGHGRAFTDSHAELPVVDAPRAALEVTDFAP
FRALADMPLGMVAHVVMKAIDPDQPASTSATVVRDVVRGAPIGFDGLLFSDDLSMGALAG
GMRGRAEAVLAAGLDVVLHCNGVMEEMVAVAEGVPVMSGEAVRRWERAEALRGPAQPVDA
DDLRARLAELLGTPQV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgttcggcgacctcgcggcccgcgacgctgccgccgggcgggaggccgcccgg
atcaacgcccggctgctggcgcagatgctggcggactgcggcgtgacggtggattgcgcc
ccggtctgcgacgtgccggtggagggtgcccacgacatcatcggcgaccgcgccttctgc
ggcgatccggcccgtgtggccgatctggcgcgggcgacctgcgaggggctgatggccggc
ggcgtgctgccggtcgtcaagcatctgcccggccatggccgggccttcaccgacagccac
gccgagctgccggttgtggacgccccgcgcgctgcgctggaggtcaccgacttcgcgccc
ttccgcgccctggctgacatgccgctcggcatggtcgcccatgtggtgatgaaggccatc
gacccggaccagcccgccagcacctcggcgaccgtggtgcgcgatgtcgtgcgcggcgcc
cccatcggtttcgacgggctgctgttcagcgacgacctgtcgatgggcgcgctggccggc
ggcatgcgcggccgggcggaggcggtcctggccgccgggctggacgtcgtgctccattgc
aacggcgtgatggaggagatggtggcggtggccgagggcgttcccgtgatgagcggcgaa
gccgtccgccgctgggagcgggccgaggcgctgcgcggcccggcgcagccggtggacgcc
gacgacctgcgggcgcgtctggcggaattgctgggaactccccaggtttag

DBGET integrated database retrieval system