KEGG   Azospirillum brasilense: AZOBR_p130080Help
Entry
AZOBR_p130080     CDS       T02152                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abs  Azospirillum brasilense
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:abs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:abs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(330137..330745)
Genome map
AA seq 202 aa AA seqDB search
MPTIRDAAQSAARSVSVMLSAVLTLSAAVPSAAAAADALDWAALPLPAIDGGTLAPDAFR
GKAVLLVNTASQCGYTGQYEGLQTLWAGRRDRGLVVLGVPSNDFGGQEPGSNAQVASFCE
LNYGVDFPLMEKQSVTGPQAHPLYRWAAAVTGPQGVPRWNFHKILIGRDGRLLEWFGSSV
TPDSATLTAAVDKALAQPSAKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgatccgcgatgccgcccaatccgccgcccgatccgtttccgtgatgctgtcc
gccgtcctgacgctgtccgcggccgtccccagcgcggcggcggcggccgacgcgctcgac
tgggcggcgctgcccctgccggccatcgacggcggcacgctcgcgcccgatgccttccgg
ggcaaggcggtgctgctggtcaacacggcgtcgcaatgcggctacaccggccagtatgag
gggctgcagacgctctgggcgggacggcgcgaccgcgggctggttgtgctgggggtgccg
agcaacgatttcggcgggcaggagcccggcagcaacgcccaggtcgcctccttctgcgaa
ctcaactacggcgtcgatttccccctgatggagaagcagtccgtcaccggaccgcaggcc
cacccgctctaccgctgggcggcggcggtcaccgggccgcagggcgtgccgcgctggaac
ttccacaagatcctgatcggccgcgacggacgcctgctggaatggttcggcagttcggtc
acgccggactccgccaccctgaccgcggccgtggacaaggcgctggcccagccctctgct
aagccgtaa

DBGET integrated database retrieval system