KEGG   Azospirillum brasilense Sp245: AZOBR_p130080Help
Entry
AZOBR_p130080     CDS       T02152                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AZOBR_p130080
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AZOBR_p130080
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AZOBR_p130080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(330137..330745)
Genome map
AA seq 202 aa AA seqDB search
MPTIRDAAQSAARSVSVMLSAVLTLSAAVPSAAAAADALDWAALPLPAIDGGTLAPDAFR
GKAVLLVNTASQCGYTGQYEGLQTLWAGRRDRGLVVLGVPSNDFGGQEPGSNAQVASFCE
LNYGVDFPLMEKQSVTGPQAHPLYRWAAAVTGPQGVPRWNFHKILIGRDGRLLEWFGSSV
TPDSATLTAAVDKALAQPSAKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgatccgcgatgccgcccaatccgccgcccgatccgtttccgtgatgctgtcc
gccgtcctgacgctgtccgcggccgtccccagcgcggcggcggcggccgacgcgctcgac
tgggcggcgctgcccctgccggccatcgacggcggcacgctcgcgcccgatgccttccgg
ggcaaggcggtgctgctggtcaacacggcgtcgcaatgcggctacaccggccagtatgag
gggctgcagacgctctgggcgggacggcgcgaccgcgggctggttgtgctgggggtgccg
agcaacgatttcggcgggcaggagcccggcagcaacgcccaggtcgcctccttctgcgaa
ctcaactacggcgtcgatttccccctgatggagaagcagtccgtcaccggaccgcaggcc
cacccgctctaccgctgggcggcggcggtcaccgggccgcagggcgtgccgcgctggaac
ttccacaagatcctgatcggccgcgacggacgcctgctggaatggttcggcagttcggtc
acgccggactccgccaccctgaccgcggccgtggacaaggcgctggcccagccctctgct
aagccgtaa

DBGET integrated database retrieval system