KEGG   Azospirillum brasilense Sp245: AZOBR_p130100Help
Entry
AZOBR_p130100     CDS       T02152                                 

Definition
(RefSeq) putative threonine synthase (TS)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOBR_p130100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOBR_p130100
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AZOBR_p130100
Enzymes [BR:abs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AZOBR_p130100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(344722..345963)
Genome map
AA seq 413 aa AA seqDB search
MPFDSNLTTERPTFVTHLECAYTGERYEADTVHNLSKAGKPLLVRYDLEGVRGALTKDAL
AERPQDLWRYRELLPVRRVQDIVSLGEAVTPLVALPKLAAKLGAAELLVKDEGRLPTGSF
KARGLVMAVSMAKAFGIKHMAMPTNGNAGAALAAYATRAGIKTTIFCPEDTPEVNVSEIE
LQGATVYRVNGLIDDCGKIVGEGKAKAGWFDVSTLKEPYRIEGKKTMGLELAEQLGWEVP
DVIFYPTGGGTGLIGMWKAFAELEAIGFIGSKRPRMVAVQAAGCAPMVRAYEAGEEHAPR
WPDAHTIASGIRVPQAVGDFLILRAVRESGGFAVAVPDEAIQAALDEAAREEGFLLCPEG
AATYAAYKQALGDGRVGRDERAVLFNCATGLKYPLPPVHRTLDRHQPIDYSVF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgcctttcgacagcaacctgaccaccgagcgcccgaccttcgtcacgcatctggaatgc
gcctacaccggcgagcggtacgaggccgacaccgtccacaacctgtccaaggccggcaag
ccgctgctcgtccgctacgaccttgagggggtgcgcggcgcgctgaccaaggacgcactg
gccgaacgcccgcaggatttgtggcgctaccgcgagctgctgccggtgcgccgggtgcag
gacatcgtcagcctgggcgaggcggtgaccccgctggtcgcgctgcccaagctcgccgcc
aagctgggggcggcggaactgctggtgaaggacgaggggcgtctgcccaccggctccttc
aaggcgcgcgggctggtcatggcggtgtccatggcgaaggccttcggaatcaagcacatg
gccatgccgaccaacggcaacgccggcgcggcgctggccgcctacgcgacgcgggccggc
atcaagacgacgatcttctgtccggaggacacgccggaggtcaacgtctccgagatcgaa
ctccagggcgccacggtctaccgcgtcaacgggctgatcgacgactgcggcaagatcgtg
ggggagggcaaggccaaggccggctggttcgacgtctccaccctgaaggagccctaccgg
atcgagggcaagaagaccatgggtctggagctggccgagcagctcggctgggaggtgccg
gacgtcatcttttacccgaccggcggcggcaccggcctgatcggcatgtggaaggccttc
gccgaactggaggccatcggcttcatcggctccaagcgcccgcgcatggttgcggtgcag
gccgccggctgcgccccgatggtccgcgcctacgaggcgggggaggagcacgcgccgcgc
tggccggatgcccacaccatcgcgtccggcatccgcgtgccgcaggcggtcggcgacttc
ctgatcctgcgcgcggtgcgggagagcggcggcttcgccgtcgccgtgccggacgaggcc
atccaggcggcgctggacgaggcggcgcgggaggagggattcctgctctgcccggagggc
gccgccacctacgccgcctacaagcaggcgctgggcgacgggcgggtgggccgcgacgag
cgcgccgtgctgttcaactgcgcgaccgggctgaagtacccgctgccgcccgtccatcgg
acgctcgaccgccaccagcccatcgactattcggtgttctga

DBGET integrated database retrieval system