KEGG   Azospirillum brasilense: AZOBR_p130170Help
Entry
AZOBR_p130170     CDS       T02152                                 

Gene name
gmk
Definition
Guanylate kinase (GMP kinase)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
abs  Azospirillum brasilense
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abs00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:413019..413666
Genome map
AA seq 215 aa AA seqDB search
MPETMNTKIARRGLMLVLSSPSGAGKTTISRRLLDRDPGITLSVSVTTRPMRPGEQPGVH
YYFVDMPEFDRMAGQGELLEHARVFGNCYGTPRHAVETALSAGRDVLFDIDWQGMQQLAA
NARADLVSVFVLPPSGTELERRLHSRGQDSAEVIAQRMAKASDEISHWGEYDYVIVNNDV
DESVQAVQAILRAERLRRTRQVGMPAFVESVQAAL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaccatgaacacgaagatcgcccggcgcggcctgatgctcgtgctgtcctcc
ccctccggggcgggcaagaccaccatttcgcgtcgccttctggaccgcgaccccggcatc
accctgtcggtgtccgtcaccacccggccgatgcgccccggcgagcagccaggcgtccat
tactacttcgtcgacatgccggagttcgaccgcatggccggacagggcgagcttctggag
cacgcccgcgtgttcggcaactgctacggcacgccgcgccacgccgtggagaccgcgctg
agcgccgggcgcgacgtgctgttcgacatcgactggcagggcatgcagcagctggcggcc
aacgcccgcgccgatctggtcagcgtcttcgtcctgccgccttcgggcaccgagctggag
cgccgcctgcactcccgcggccaggactcggcggaggtgatcgcccagcgcatggccaag
gcgtcggacgagatcagccactggggcgaatacgattacgtgatcgtcaacaacgacgtg
gacgagagcgtgcaggcggttcaggccatcctgcgcgccgagcggctgcgccggacgcgg
caggtcgggatgccggcctttgtggagagcgtgcaggcggcgctgtaa

DBGET integrated database retrieval system