KEGG   Azospirillum brasilense Sp245: AZOBR_p130183Help
Entry
AZOBR_p130183     CDS       T02152                                 

Gene name
holC
Definition
DNA polymerase III, chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AZOBR_p130183 (holC)
   00240 Pyrimidine metabolism
    AZOBR_p130183 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AZOBR_p130183 (holC)
   03430 Mismatch repair
    AZOBR_p130183 (holC)
   03440 Homologous recombination
    AZOBR_p130183 (holC)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AZOBR_p130183 (holC)
DNA replication proteins [BR:abs03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AZOBR_p130183 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:425956..426405
Genome map
AA seq 149 aa AA seqDB search
MTEVRFYHLQRRTLEQALPKILEKVLERGWRAVVLAGSPERVDALNQHLWTYDPSSFLPH
GASRDGFAAEQPVWLTAEEENPNGATVLVLVDGVTSDAMGSFDLVCDLFDGNDGDAVLAA
RDRWKICKAAGHALTYWQQNDRGGWEKRA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtccgtttctatcacctccagcggcgcacgctcgaacaggcgttgccgaag
attctggaaaaggtcctggagcgcggttggcgcgccgtcgtcctggccggctcgccggag
cgggtggacgcgctcaatcagcatttgtggacctacgatccttcctccttcctgccgcac
ggcgcgtcccgcgacggcttcgccgccgaacagccggtctggctgaccgccgaggaggaa
aaccccaacggggccaccgtcctggttctggtggacggggtgaccagcgacgcgatgggc
tccttcgacctcgtctgcgacctgttcgacggcaatgacggcgacgcggtgcttgccgcc
agggaccgttggaagatctgcaaggccgccggacacgccctcacctactggcagcaaaac
gaccgcggcggttgggaaaagcgcgcctga

DBGET integrated database retrieval system