KEGG   Azospirillum brasilense Sp245: AZOBR_p140023Help
Entry
AZOBR_p140023     CDS       T02152                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (BDH) (3-hydroxybutyrate dehydrogenase) (3-HBDH)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AZOBR_p140023
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AZOBR_p140023
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AZOBR_p140023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:complement(489759..490544)
Genome map
AA seq 261 aa AA seqDB search
MTLTQKVAVVTGSTSGIGLGIARALAGAGADVVLNGFGEAAAIEELRAGLAAEFGVRVGY
HGADLSKPAEIAALIGHAEETFGSVDVLVNNAGIQHVAPVEDFPAERWDAVIALNLSAVF
HGTHHALPGMKRRGWGRILNIASVHGHVASVNKSAYVAAKHGVVGLTKTVALETAGTGVT
CNAICPGWVLTPLVQKQIDAIASTKNIPEPQAKAELLGAKQPSGAFVTPDELGGLAVFLC
SDSAAQMTGASLLMDGGWTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgactcagaaggtcgcggtggtcaccggctcgaccagcgggatcggcttgggc
atcgcgcgggcgctggccggagccggggcggacgtggtgctgaacgggttcggcgaggcg
gccgccatcgaggaactgcgcgccggtctggcggcggagttcggcgtgcgcgtcggctat
cacggcgccgacctgtccaagccggcggagatcgccgcgctgatcggccacgcggaggag
acgttcggctccgtcgatgtgctggtgaacaacgccggcatccagcacgtcgccccggtg
gaggacttcccagcggagcgctgggacgcggtgattgcgctcaacctgtccgccgtcttc
cacggcacccaccacgccctgccgggcatgaagcggcgcggctggggccgcatcctcaac
atcgcctccgtgcacgggcacgtcgcgtcggtcaacaagtcggcctacgtcgcggccaag
cacggcgtggtcgggctgaccaagacggtggcgctggagacggcgggcaccggcgtcacc
tgcaacgccatctgtccgggctgggtgctgaccccgctggtgcagaagcagatcgacgcg
atcgcctcgaccaagaacatcccggagccgcaggcgaaggcggagctgctcggcgccaag
cagccctccggcgccttcgtgacgccggacgaactgggcgggctggcggtcttcctgtgc
tccgattcggcggcgcagatgaccggcgccagcctgctgatggacggcggctggaccgcg
cagtaa

DBGET integrated database retrieval system