KEGG   Azospirillum brasilense: AZOBR_p150084Help
Entry
AZOBR_p150084     CDS       T02152                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; isopentenyl monophosphate kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
abs  Azospirillum brasilense
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZOBR_p150084 (ispE)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AZOBR_p150084 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p1:646714..647742
Genome map
AA seq 342 aa AA seqDB search
MSAIAEAAPAKLNLYLHVVGRRDDGYHELDSLVAFADVADRVTVQPGVARIALRGVDLPP
VGPRLAISGPFGPALMGENPAHNLVIRAAHALAARLGREADAMIALEKVLPVASGIGGGS
ADAAATLRALARLWDVPVTDRRVYEVAASLGADVPVCVAGRSCYFGGVGEVLEEAPALPE
TFAVLVNPGVPVPTPAVFKARKDTVKSIFSAPTRFTEAPADAATLAALLKERRNDLTEPA
LTVAPVIADALAALEGTDGCLLARLSGSGATCFGLYADAAAAGAAARSIQAAQPRWWAKS
ARLLPTPADAPPLPKGLVAPSAVTTAPAPPVPFPDTGGWGVG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatcgccgaggccgcgccggccaagctgaacctctatctgcatgtggtgggc
cgccgggacgacggctatcacgagttggacagccttgtcgccttcgccgacgtggcggac
cgcgtgacggtgcagccgggcgtcgcgcggatcgcgctgcgcggggtggacctgccgccg
gtcgggccgcggctggccatctccggccccttcggcccggctctgatgggggagaacccg
gcgcacaacctcgtcatccgcgccgcccacgcgctggccgcccggcttggacgcgaggcc
gacgccatgatcgcgctggagaaggtgctgcccgtcgcctccgggatcggcggcggatcg
gcggacgccgcggcgacgctgcgcgccctggcccggctgtgggacgtgccggtgaccgac
cggcgggtctacgaggtcgcggcctcgctgggcgccgatgtgccggtctgcgtcgccggg
cggagttgctatttcggcggcgtgggagaggtgctggaggaggcgccggccctgccggaa
acctttgcggttctggtcaaccccggcgtgccggtgccgacacccgctgtgttcaaggcc
cgcaaggacaccgtcaagagcatcttctcggcaccgacccgcttcaccgaggcgccggcc
gacgccgcgacgctggccgcgctgctgaaggagcggcgcaacgacctgaccgaaccggcg
ctgaccgtcgccccggtgatcgccgacgcgctggcggccctggagggcacggacggctgt
ctgctggcccgcctgtcgggcagcggagcgacctgcttcggcctttatgccgatgcggcg
gcggcgggcgcggccgcccggtcgatccaggcggcgcagccgcgctggtgggcgaagtcc
gcgcggctcctgccgaccccggcagacgcgccgccgctgcccaagggactggtggcgcca
tccgcggtcaccaccgccccagcgccgccggtccccttcccggacaccggcggctggggc
gtcggctga

DBGET integrated database retrieval system