KEGG   Azospirillum brasilense: AZOBR_p210070Help
Entry
AZOBR_p210070     CDS       T02152                                 

Gene name
asnB
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
abs  Azospirillum brasilense
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p2:66600..68375
Genome map
AA seq 591 aa AA seqDB search
MCGISGEIRFDSRPASASAVGSMTEALALRGPDGQGVFAHGRMAFGHRRLSIIDLSEAAQ
QPMTDPELGLGIVFNGCIYNYPELRAELEAKGYRFFSHGDTEVLLKAYHAWGRRFVERLY
GMFAFAIWERDSGRVTLGRDRLGIKPLYLSETAGRLRFASTLPALLAGGDIDTTIDPVGL
YQYMSFHAVVPAPGTILKGVRKLPPATLLTLEPDGRRIEETYWEPVFGPPPGDERMSEGD
WQDAVLSTLRKAVERRLVADVPVGVLLSGGLDSSVIVALLAEAGQTGLQTFSIGFETVGQ
EKGDEFQYSDLIAQRFQTDHHKLFIDSNRALPALQDCVRAMSEPMVSHDAIGFFLLSQEV
AKHVKVVQSGQGADEIFAGYHWYPPMMEAADPLSTYAKVFFDRNRAEMAEALNPQYLADE
DAASAFVAAHFARPGADRPVDKALRLDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHDL
VELAARVPPELKVRDGGKYVLKEAARKVVPSEVIDRPKGYFPVPALKYLRGPYLELVRDV
LNQPAARKRALFQPAYLDRLFSDPETHITPLRGSKLWQAALLEFWLQTHGI
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcagcggggaaatccgcttcgattctcgcccggcctccgcatccgcggtc
ggctcgatgaccgaagccctggcgttgcgcggccccgacgggcaaggcgtcttcgcccat
ggcaggatggccttcggccaccggcggctgagcatcatcgacctgtccgaggcggcgcag
cagccgatgaccgaccccgagctgggcctcggcatcgtcttcaacggctgcatctacaat
tacccggaactgcgggcggagttggaagccaagggctaccgcttcttctcgcacggcgac
accgaagtcctgctgaaagcctatcacgcctggggccgccgcttcgtcgaacggctctac
ggcatgttcgccttcgccatctgggagcgcgacagcgggcgcgtcacgctgggccgcgac
cggctgggcatcaagccgctctacctatccgagacggcgggacggctgcgcttcgcctcc
accctgcccgccctgctggccggcggcgacatcgacacgacgatcgacccggtggggctc
taccagtatatgagcttccacgccgtcgttccggcgccggggaccatcctgaagggcgtg
cgcaagctgccgccggccaccctgctgacgctggagccggacggacgccgcatcgaggaa
acctattgggaacccgtcttcggcccgccgcccggcgacgaacgcatgtcggaaggcgac
tggcaagacgccgtgctgtccacgctgcgcaaggcggtggagcggcgtctggtcgccgac
gtgccggtcggcgtgctgctgtcgggcggtctggacagctccgtcatcgtcgccctgctg
gcggaggccgggcagaccggcctgcagaccttctccatcggcttcgagacggtgggccag
gagaagggcgacgagttccagtattccgacctgatcgcccagcgcttccagaccgaccat
cacaagctgttcatcgacagcaaccgcgccctgcccgcccttcaggactgcgtgcgggcg
atgtcggaaccgatggtcagccacgacgccatcggcttcttcctgctgtcgcaggaggtc
gccaagcatgtgaaggtggtgcagagcggccagggcgccgacgagatcttcgcgggctac
cactggtacccgccgatgatggaggcggcggacccgctgtccacctacgccaaggtcttc
ttcgaccgcaaccgcgcggagatggccgaagcactgaacccgcagtatctggccgacgag
gacgcggcgagcgccttcgtcgccgcccatttcgcccggcccggcgccgaccgcccggtg
gacaaggcgctgcgcctcgacaccacggtcatgctggtcgacgacccggtgaagcgggtc
gacaacatgaccatggcctgggggctggaggggcgcgtccccttccttgaccacgatctg
gtcgagttggccgcccgcgtcccgccggagctgaaggtgcgcgacggcggcaaatacgtg
ctgaaggaggcggcgcgcaaggtcgtcccctccgaggtcatcgaccggcccaagggctat
ttccccgttccggcgctgaagtacctgcgcggtccctatctggagctggtgcgcgacgtg
ctgaaccagcccgccgcgcggaagcgcgctttgttccagccggcctatctcgaccgcctg
ttcagcgatccggaaacccacatcacgccgcttcgcggttccaagctctggcaggccgcc
ctgctggagttctggctgcaaacccacgggatctga

DBGET integrated database retrieval system