KEGG   Azospirillum brasilense Sp245: AZOBR_p280064Help
Entry
AZOBR_p280064     CDS       T02152                                 

Definition
(GenBank) cytochrome C
  KO
K08738  cytochrome c
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs01100  Metabolic pathways
abs01120  Microbial metabolism in diverse environments
abs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOBR_p280064
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p280064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CCD02178
UniProt: G8AW69
Position
AZOBR_p2:831806..832177
Genome map
AA seq 123 aa AA seqDB search
MKRSVAVLAFGLFAALPSIASAQDADAGEKVFNQCKACHTIEAGGPNRVGPNLHGVVGRP
SGSIESFKYSDAMKGAGLAWDEANLDKYLTDPKGTVPGNKMAFAGVKNEQARKDLIAFLK
KNS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtagtgttgccgttctggccttcggcctgttcgccgcccttcccagcatcgcc
tcggcgcaggacgccgatgcgggtgagaaggtgttcaaccagtgcaaggcctgccacacc
atcgaggccggcggccccaaccgcgtcggcccgaacctgcacggcgtcgtcggccgcccg
tcgggctccatcgagagcttcaagtattccgacgccatgaagggcgccgggctggcttgg
gacgaggccaatctcgacaagtacctgaccgatccgaaggggactgtccccggcaacaag
atggccttcgccggcgtgaagaacgagcaggcgcgcaaggacctgatcgccttcctgaag
aagaacagctga

DBGET integrated database retrieval system