KEGG   Azospirillum brasilense: AZOBR_p280095Help
Entry
AZOBR_p280095     CDS       T02152                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abs  Azospirillum brasilense
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AZOBR_p280095 (glpK)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AZOBR_p280095 (glpK)
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOBR_p280095 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p2:866599..868104
Genome map
AA seq 501 aa AA seqDB search
MSEAGHVLAIDQGTTSTRAIVFDRRGVPAGVARREFAQHYPADGWVEHDPEDIWRDTVAV
MRGAVDEAGLSAADIAAIGITNQRETTVVWDRRTGEPVHRAIVWQDRRTSDLCRKLVEEG
CGPLVRRKTGLLIDSYFSATKIAWILDHVPGARERAERGELCFGTIDSFLLHRLTGGRVH
ATDATNASRSMVFDIHRQDWDDELLALFRIPRAMMPEVLDSSAEFGATEPDLLGRAIPIT
GIAGDQQAATFGQACFQPGMVKSTYGTGCFALLNTGDEPVESRSNMLTTVAYRLDGRTTY
ALEGSIFIAGAAIKWLRDGLGIITHASQTDDMATRVPDSHGVYLVPAFVGLGAPHWDPQA
RAAIFGLTLDAGPAHIARAALEAVAFQTRDLRDAMVSDWSAAHTATSDALRVDGGMAAND
WLCQFLADVLDLPVERPAVIETTALGAAGLAGLKVGVYRDQAALAGAWRCDRRFEPRMDA
AKRVRLYDGWLDAVRRVRRER
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagccggccacgtcctcgccatcgatcagggcaccacctccacccgcgccatt
gtcttcgaccggcggggcgttcccgccggggtggcccggcgcgagttcgcgcagcattat
cccgccgacggctgggtggaacacgatccggaggacatctggcgcgacaccgtggcggtg
atgcggggcgccgtggacgaggccgggctgagcgccgcggacatcgccgccatcggcatc
accaaccagcgcgaaaccaccgtcgtctgggaccgccgcaccggcgagccggtgcaccgc
gccatcgtctggcaggaccgccgcacctccgacctctgccgcaagctggtcgaggagggc
tgcgggccgctggtgcggcgcaagaccgggctgctgatcgattcctacttctccgccacc
aagatcgcctggattctcgaccatgttcccggcgcgcgggagcgggcggagcggggcgaa
ctgtgcttcggcaccatcgacagcttcctgctgcaccggctgaccggcgggcgggtgcac
gccaccgacgcgaccaacgcctcgcgcagcatggtcttcgacatccaccgccaggactgg
gacgacgagttgctcgccctgttccgcatcccccgcgccatgatgccggaggtgctggac
agcagcgccgagttcggcgcgacggagccggacctgctgggccgcgccatccccatcacc
ggcatcgccggcgaccagcaggcggcgaccttcgggcaggcctgcttccagccgggcatg
gtgaaatcgacctacggcaccggctgcttcgccctgctgaacaccggcgacgaaccggtg
gaatcgcgctccaacatgctgaccacggtggcctaccggctcgacgggcggacgacctac
gcgctggagggctccatcttcatcgccggggcggccatcaagtggctgcgcgacgggctg
gggatcatcacccacgcctcccagaccgacgacatggcgacccgcgtaccggacagccac
ggcgtctatctggtgccggccttcgtgggcctgggcgccccccattgggacccgcaggcc
cgcgccgccatcttcggcctgacgctggacgccggcccggcccacatcgcccgcgccgcg
ctggaggcggtggccttccagacccgcgacctgcgcgacgccatggtctccgactggtcg
gccgcgcacacggcgacctccgacgcgctgcgggtggacggcggcatggcggcgaacgac
tggctgtgccagttcctggccgacgtgctggacctgccggtggaacgcccggcggtgatc
gagacgaccgcgctgggcgccgccgggctggccgggctgaaggtcggggtctaccgcgat
caggctgcactcgccggtgcgtggcgttgcgaccgccggttcgagccgcggatggacgcg
gccaagcgggtccgcctttacgacggctggctggacgccgtgcgccgcgtgcggcgcgaa
cgctga

DBGET integrated database retrieval system