KEGG   Azospirillum brasilense: AZOBR_p280123Help
Entry
AZOBR_p280123     CDS       T02152                                 

Gene name
melA
Definition
alpha-galactosidase (Melibiase)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
abs  Azospirillum brasilense
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:abs00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:abs00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:abs00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p2:complement(889424..890719)
Genome map
AA seq 431 aa AA seqDB search
MAVTTRKTTKIVFLGAGSAAFGLSMYRDLFTTTELAGSTLTLVDTNPAALDRMTALARLL
NAKGDAGLIIEQTTDRRAALQGAEFVVNSVAIDRNRLWKLDFEVPKKHGIRHTLGENGGP
GGLFFTLRTLPLIFDFARDIEELCPEAQFINLSNPESRVVLGLGKYTKVKTLGLCHGIFL
ARWFICQILGMAEKDVEVWGAGLNHFQWLMHIRDKESGRDLYPLLREREKTHDPAFTPLT
RRLFNSFGLWPTCSDDHMGEYLPYGWEGGEHGFDFAEDERGRGILNALMDGTIAGTTPVP
DDWTQPSWGERAVQVIAGVLHNQKRFIESGIVYNQGAIPNLPPDLAVEVPLLADAAGVHP
VSLGPLPDPVAKLLHVQASVQQLSVEAAVHASKDLALQALLIDPVVNSTDAAVKILDELW
EANRPYIRPCV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaccactcgcaaaaccaccaagatcgtctttctgggcgccggcagcgcggcc
ttcgggctgagcatgtaccgcgacctcttcaccacgacggaactggcgggcagcaccctg
acgctggtggacacgaatccggcagccctcgaccgcatgaccgcgctcgcccgcctgctg
aacgccaagggcgacgccggcctgatcatcgaacagaccaccgaccgccgcgccgccctg
caaggcgcggaattcgtcgtcaactccgtcgccatcgaccgcaaccgcttgtggaagctc
gatttcgaggtgccgaagaagcacggcatccgccacacgctcggcgaaaacggcggaccc
ggcggactgttcttcacgctgcgcaccctgcccctgatcttcgacttcgcccgcgacatc
gaggaactgtgcccggaggcccagttcatcaacctgtcgaatccggaaagccgcgtcgtc
ctcggcctcggcaaatacaccaaggtcaagacgctggggctgtgccacggcatcttcctg
gcgcgctggttcatctgccagatcctcggcatggccgaaaaggatgtggaggtctggggc
gccggactgaaccacttccagtggctgatgcacatccgtgacaaggagagcggacgcgac
ctctacccgctgctgcgcgagcgggagaagacccacgacccggccttcacgccgctgacc
cgccgcctgttcaacagcttcggcctgtggccgacctgcagcgacgatcatatgggcgaa
tacctcccctacggctgggagggcggggagcatggattcgacttcgcggaggacgagcgc
gggcgcggcatcctcaacgcgctgatggacggaacaatcgccggaacgacgccggtgccc
gacgactggacgcagccatcctggggcgagcgggcggtgcaggtcatcgccggggttctg
cacaaccagaagcgcttcattgaatcggggatcgtctacaaccagggcgccatccccaac
ctgccgcccgatctggcggtggaggtgccgctgctggccgacgcggcgggcgttcacccg
gtctcgctcggccccctgcccgacccggtcgccaaactgctgcacgttcaggcgagcgtg
cagcaactgtccgtcgaggcggcggtccacgcctcgaaggacttggcgctccaggctctg
ctgatcgacccggtggtgaattccaccgacgccgccgtgaagatcctggacgagctgtgg
gaggcgaaccggccctacatccgtccctgtgtgtag

DBGET integrated database retrieval system