KEGG   Azospirillum brasilense Sp245: AZOBR_p310014Help
Entry
AZOBR_p310014     CDS       T02152                                 

Definition
glycosyl hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
abs  Azospirillum brasilense Sp245
Brite
Enzymes [BR:abs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AZOBR_p310014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p3:17040..18176
Genome map
AA seq 378 aa AA seqDB search
MRAQRIGRRAVLSGLGAGLVLASPGNGTTAGSKPIGLRAIAASRGLAYGAALGLRSVDED
QALADAYTRECAVLVPEGDAKWAGLRPAAGVFRFDGLDRLLGIADRHGQSVRGHTLLWHE
ALPAWVPEALRAGQGYDILSDHIFTVVGRYRGRIPVWDVVNEAVAPDEGREDGLRPTPWL
RALGPRCLDLAFKAARAADPGAVLMLNDHDLEYASPLQDRRRRAVLRLLETLLARGVPVD
GLGLQSHLRIGRPFDPRILHRFIGEVGGLGLMVMITELDVGDAAVTGDIPTRDQAVADHA
SAFLDTVLDHACVKAVTCWGLSDRQSWLHHHPAGWRPDGQPMRPLPLDVELRPKPLWQAL
GDAFRNAPKRSSAAWMPG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgcagcggatcggccgtcgtgccgtgctgtcgggcttgggcgccgggctggtc
ctggccagcccgggcaatgggacgaccgccgggtccaagccgatcggactgcgtgccatc
gcggcatcgcgcggattggcctacggcgccgcgttagggcttcggtccgtggacgaggat
caggccttggccgatgcctacacgcgcgaatgcgccgttttggtcccggaaggcgacgcg
aaatgggcgggcttgcgtccggccgccggcgtctttcgtttcgacggcctcgatcgcctg
cttgggatcgcggaccgtcatggacagagcgtgcgcggacacacgctgctgtggcacgag
gctctgccggcctgggtcccggaagcgcttcgggcgggacaaggctacgacattttatcc
gaccatatcttcacggtggtgggcagataccgggggcgcattccggtttgggacgtggtg
aacgaagcggtcgcaccagacgaggggcgcgaggatgggcttcgcccgaccccctggctg
cgcgcgctgggaccgcgttgcctcgatctggcgttcaaggcggcgcgggcggcggatccg
ggcgccgtgttgatgctcaacgaccatgatctggagtatgcgtcacccttgcaggatcgg
cgccggagggccgtcctgcggcttcttgagacgctgttggcgcgcggtgtgccggtcgat
gggctggggcttcaatcgcatcttcggataggccgccccttcgaccctcgcatcctgcat
cgcttcatcggagaggttggcgggctggggctgatggtgatgatcactgaattggacgtc
ggcgatgccgccgtgaccggcgacatcccgacgcgggaccaagccgtcgcggaccatgcc
agcgcctttctcgacaccgtgttggaccatgcctgcgtcaaggccgtgacctgctggggc
ctgtccgaccgccaaagctggcttcaccaccacccggcgggttggcggcccgatgggcag
cccatgcgcccgctgccgctggatgtggaattgcggcccaagccgctctggcaagcgttg
ggggacgccttccgcaacgctccgaaacggtcgtcggcggcatggatgcccggctga

DBGET integrated database retrieval system