KEGG   Azospirillum brasilense Sp245: AZOBR_p310092Help
Entry
AZOBR_p310092     CDS       T02152                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (fragment)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOBR_p310092
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p310092
   00020 Citrate cycle (TCA cycle)
    AZOBR_p310092
   00620 Pyruvate metabolism
    AZOBR_p310092
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZOBR_p310092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p3:complement(86336..87337)
Genome map
AA seq 333 aa AA seqDB search
MARAPPPLREPAETPAANPAPTPVATNARPLPAPVRANGERILSTPLARRRAEGLGVDLG
TVTGSGPRGRIKVADVEAAAQTRPAPQPAPQVPKVEASAGERSKPTTLQATIARRLTAAK
RDVPHFYLAAEAEVTELAALRDRLNADTESGLPRISMTHLVLAAVGRALAAMPEMDRVWD
DEPSGGAILSLGQGDIGMAVDTPRGLVAPVLRGAATLPLDRLAAEAASLTRRARDGRLTE
EDFQGGAVTVSNAGMHNVTYMTSIINPGQSSILGVGSVRSVFRPDEAGAPVLKRELGLVL
SADHRLFDGVTALAFLNRIIAGLERPLRLLRAA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcgccgcccccgctccgggagccggcggagacgcccgccgcgaaccccgcc
ccgacacccgtcgccaccaacgcccgccccctgcccgccccggtccgcgccaacggggag
cgcatcctgtcgactcccctcgcccgccgccgcgccgaggggctgggcgtcgatctcggg
acggtgaccggcagcggcccgcgtggccgcatcaaggtggccgatgtcgaggcggcggct
caaacgcggccagcgcctcagcctgcaccccaggtgccaaaggtcgaggcttccgccggg
gaacggtcgaagcccaccaccttgcaagcgaccatcgcccgtcgcctgaccgccgccaag
cgcgacgtcccgcacttctacctcgccgccgaggccgaggtgacggagctggcggcgctg
cgcgaccggttgaacgccgacaccgagtccggacttccgcggatttcgatgacccatctg
gtgctggccgcggtcgggcgggcgctcgccgccatgccggaaatggaccgggtgtgggac
gacgagccttccggcggcgcgatcctcagcctcgggcagggcgacatcggcatggcggtg
gacacgccgcgcgggctggtcgccccggtgctgcgcggggcggcgaccctgccgctcgac
cgactggcggcggaggccgcgtcgctgacccgccgcgcccgcgacggccgcctgacggag
gaggacttccagggcggcgccgtcaccgtgtcgaacgccggcatgcacaacgtcacctac
atgacctcgatcatcaatcccggccagtcgagcatcctcggcgtcggcagcgtccgctcc
gtcttccgtcccgacgaggcgggagccccggtgctgaagcgcgaactcggcctcgtcctg
tcggcggaccaccggctgttcgacggcgtgaccgccctggccttcctcaaccgcatcatc
gccgggctggagcggcctttgcgcctgcttcgcgccgcctga

DBGET integrated database retrieval system