KEGG   Azospirillum brasilense: AZOBR_p310214Help
Entry
AZOBR_p310214     CDS       T02152                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (BDH) (3-hydroxybutyrate dehydrogenase) (3-HBDH)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abs  Azospirillum brasilense
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:abs00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:abs00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p3:206149..206928
Genome map
AA seq 259 aa AA seqDB search
MRNRNAVVTGSTTGIGLATARELARQGCHVMLNGFGDRAEIDRLCTEIAAQSGTTIVYSG
ADLSRPEEARAMMADAAAALGPIDILVNNAGVQHVAAVHEFPDDKWDLLLAVNLSAAFHT
IKAALPAMRERRWGRIVNTASVLGMVGAPHKPAYVATKHGIIGLTKSVAIEVAEHGITCN
AVCPGTVLTPIIEKQIAQQAQVTGLPEERVLQAVFLDRMPTGRLIPPEEVAAAIAFLCSD
AAASITGTAIPVDGGYTTH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacaggaacgctgtcgtcaccggctccaccaccggcatcgggctggcgaccgcc
cgcgaactcgcccgccagggttgccatgtcatgctcaacggcttcggcgaccgcgcggag
atcgaccggctgtgcacggagatcgcggcgcagagcggcacgacgatcgtctattcgggg
gccgacctcagccggccggaggaggcccgcgccatgatggccgacgccgcggcggcgctc
ggccccatcgatatcctggtgaacaacgccggggtgcagcatgtggcggcggtgcacgag
ttccccgacgacaaatgggacctgctgctcgcggtcaacctcagcgccgcctttcacacc
atcaaggcggcccttcccgcgatgcgggagcgccgctgggggcgcatcgtcaacacggcg
tcggtcctcggcatggtcggcgctccgcacaaacccgcctatgtcgcgaccaagcacggc
atcatcggcctgacgaagtcggtggcgatcgaggtcgcggagcacggcatcacctgcaac
gcggtgtgccccggcacggtgctgaccccgatcatcgagaagcagatcgcccagcaggcg
caggtcaccggcctgccggaggaacgggttctgcaggcggtgttcctcgaccgcatgccg
accggccggctgattccgccggaggaggtcgcagccgccatcgccttcctgtgctccgac
gccgccgcgtcgattaccggcacggcgatccccgtggacggcggctacacgacccattga

DBGET integrated database retrieval system