KEGG   Azospirillum brasilense: AZOBR_p330086Help
Entry
AZOBR_p330086     CDS       T02152                                 

Gene name
xylA
Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
abs  Azospirillum brasilense
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:abs00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:abs00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p3:complement(433599..434906)
Genome map
AA seq 435 aa AA seqDB search
MTEAYFTGVERIRYEGPDSDTPLAYRWYDPDRMVLGRRMADHLRVAVCYWHSFCWPGSDP
FGGGTLDRPWMRAGDPVALAEAKMDVAFELFGKLGVPFFTFHDRDVAPEMGSLRETQATF
ARLTERLQGCIERSGVKLLWGTANLFSHPRYMAGAATNPDPEVFACAAAQVRDALEATHR
LGGVNYVLWGGREGYDTLLNTDMARELDQLGRFLTMVVEHKHKIGFTGTILIEPKPMEPT
KHQYDHDVATVYGFLKRYGLEKEVAVNIEVNHATLAGHSFEHEVATALALGVFGSIDMNR
GDPQNGWDTDQFPNDHVELALPMARILESGGFTTGGFNFDAKIRRQSVEPDDLLHAHVGG
IDTLARALLAGARLVEDGRLRSLRAERYAGWKGDLGQKLLGGLDLAGAADAGLGFDPRPR
SGRQEMLENLVNRLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatttcaccggcgtcgagcgcatccgttacgaaggaccggacagcgac
accccgctcgcctaccgctggtacgaccccgaccgcatggtcctgggccggcggatggcc
gaccacctgcgcgtcgccgtctgctactggcacagcttctgctggcccggttccgatccc
ttcggcggcggcacgctggaccggccctggatgcgcgccggcgatccggtggcgctggcc
gaggcgaagatggacgtggcgttcgagctgttcgggaagctcggcgtgcccttcttcacc
ttccacgaccgcgacgtggcgcccgagatgggctcgctgcgggaaacgcaggcgaccttc
gcccgcctgaccgagcggttgcagggctgcatcgagcgcagcggcgtcaaactgctgtgg
ggcaccgccaacctgttctcgcacccccgatacatggccggcgcggccaccaaccccgac
ccggaggtcttcgcctgcgcggcggcgcaggtgcgcgacgcgctggaggcgacgcaccgg
ctgggcggcgtcaattacgtgctgtggggcgggcgcgagggctacgacacgctgctcaac
accgacatggcgcgcgagctggaccagctcggccgcttcctgacgatggtggtcgaacac
aagcacaagatcggcttcaccggcaccatcctgattgagcccaagcccatggagccgacc
aagcaccagtacgaccacgacgtggcgacggtctacggcttcctgaagcgctacgggctg
gaaaaggaggtcgccgtcaacatcgaggtcaaccacgccacgctggccggccacagcttc
gagcatgaggtggcgacggcgctggcgctgggcgtcttcggctccatcgacatgaaccgg
ggcgacccgcagaacggctgggacaccgaccagttccccaacgaccatgtggagctggcg
ctgcccatggcgcgcatcctggagtccggcggcttcaccaccggcggcttcaacttcgac
gccaagatccggcgccagagcgtcgagccggacgacctgctgcacgcccatgtcggcggc
atcgacacgctggcccgcgcgctgcttgccggggcgcgcctcgtcgaagacggccggctg
cgcagcctgcgcgcggagcgctacgccggttggaagggcgatctcgggcaaaagctcctt
ggcgggctggatctcgccggagcggcggacgccggccttggcttcgatccccggccgcgg
tcgggccggcaggagatgttggagaatctggtgaaccgcctcgtctga

DBGET integrated database retrieval system