KEGG   Azospirillum brasilense Sp245: AZOBR_p330145Help
Entry
AZOBR_p330145     CDS       T02152                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOBR_p330145 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_p330145 (atoB)
   00640 Propanoate metabolism
    AZOBR_p330145 (atoB)
   00650 Butanoate metabolism
    AZOBR_p330145 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_p330145 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AZOBR_p330145 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOBR_p330145 (atoB)
   00310 Lysine degradation
    AZOBR_p330145 (atoB)
   00380 Tryptophan metabolism
    AZOBR_p330145 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZOBR_p330145 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOBR_p330145 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p330145 (atoB)
Enzymes [BR:abs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZOBR_p330145 (atoB)
Exosome [BR:abs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOBR_p330145 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
AZOBR_p3:492288..493478
Genome map
AA seq 396 aa AA seqDB search
MDTLDPVVIVSAARTPLGRFQGELSALPAHALGAHAVRAALSRAGLAPERVDEVLLGCVL
PAGQGQAPARQAARGAGLPDATGATTVNKVCGSGMKATMLAHDLIRAGSADLVVAGGMES
MSNAPYLLAKARGGYRIGHDRILDHLMLDGLEDAYEGGRPMGDFGEATADLYGFTRAEQD
AYAVETLTRARAAIASGAFTAEIAPVTLAVKGGERTVADDENPLKVAPEKIPALKPAFRR
DGTITAASSSANADGAAALLLTRRSLAEREGLPVLATILGHATHSQDPAWFTTAPIPAIR
KLLDRVGWGIGDVDLFEINEAFAVVAMAAQRDLGIPRDALNVNGGACALGHPIGATGARL
IVTLLHALAARGLRRGVASLCIGGGEATAIAVERPA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataccctcgaccccgtcgtcatcgtgtccgccgcgcgcacaccgctcggccgtttc
cagggggagctgtcggctctgcccgcccacgcgctgggcgcccacgcggtccgcgccgcc
ctgagccgcgccggtctggcgccggagcgcgtggacgaggtgctgctcggctgcgtgctg
cccgccggccaggggcaggcgccggcccggcaggcggcgcgcggcgccggtctgcccgac
gccaccggcgccaccaccgtcaacaaggtctgcggctccggcatgaaggcgacgatgctc
gcccacgacctgatccgcgccggctccgccgacctcgtggtcgcgggcggcatggagtcg
atgtccaacgcgccctatctgctggccaaggcgcgcggcggctaccgcatcgggcacgac
cgcatcctcgaccacctgatgctcgacgggctggaggacgcctatgagggcgggcgcccg
atgggcgatttcggcgaggcgaccgccgacctctacggcttcacccgcgccgagcaggac
gcctacgccgtcgagacgctgacccgcgcccgcgccgccatcgcgagcggcgctttcacc
gccgagatcgcgcccgtcaccctcgccgtcaaaggtggcgagcgcaccgtcgccgacgac
gagaacccgctgaaggtcgcgccggagaagattcccgccctgaagccggccttccgccgc
gacggcacgatcaccgcggccagttcctcggccaacgccgacggggcggcggcgctcctg
ctcacccgccgctcgctggccgagcgcgaggggctgcccgtgctggcgaccatcctcggc
cacgccacccacagccaggacccggcctggttcaccaccgcacccatcccggcgatccgc
aagctgctcgaccgcgtcggttggggtatcggcgacgtcgatctgttcgagatcaacgag
gccttcgcggtcgtcgccatggcggcgcagcgggacctcggcattccgcgcgacgcgctg
aacgtcaacggcggggcctgcgcgctcggccatcccatcggcgccaccggcgcgcggcta
atcgtgacgctgctgcacgcgctggccgcgcgggggctgcgccgcggcgtcgcctccttg
tgcatcggcggcggcgaggccaccgccatcgcggtcgaacggcccgcctga

DBGET integrated database retrieval system