KEGG   Azospirillum brasilense: AZOBR_p330159Help
Entry
AZOBR_p330159     CDS       T02152                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
abs  Azospirillum brasilense
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZOBR_p330159
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOBR_p330159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p3:506908..507276
Genome map
AA seq 122 aa AA seqDB search
MKRMFALLAFGLVASSPGLAAAQDADAGAKVFNQCKACHTIEAGGPNRVGPNLHGVVGRK
AGAVETYKYSDAMKNAGAWDEATLDAYLADPKSAVPGNKMAFAGVKNEQARKDLIAYLKK
NS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatgtttgccctgctcgccttcgggctggtcgcgtcgtcccccggcctcgcc
gccgcgcaggacgccgatgccggtgcgaaggtgttcaaccagtgcaaggcctgccacacc
atcgaagccggcggcccgaaccgcgtcggccccaacctgcatggcgtcgtcggccgcaag
gccggtgccgtcgaaacctacaagtattccgatgccatgaagaacgccggggcctgggac
gaggcgacgctcgacgcctatctggcggacccgaagagcgccgtccccggcaacaagatg
gccttcgccggcgtgaagaacgagcaggcccgcaaggacttgatcgcctatctgaaaaag
aacagctga

DBGET integrated database retrieval system