KEGG   Azospirillum brasilense: AZOBR_p430041Help
Entry
AZOBR_p430041     CDS       T02152                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abs  Azospirillum brasilense
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZOBR_p430041
Enzymes [BR:abs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AZOBR_p430041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:complement(174313..175272)
Genome map
AA seq 319 aa AA seqDB search
MSSTLTNPPRRELQSFLDFPICTDLDQLDGHIGILGIPYGDPYSIDEVTNDQTNAPTWVR
RYTERALRQLERWDFDIGGPLLGGKDIKVVDCGDVKANPRDLDLHYRNAEAVVRAMLAKG
MLPIIIGGDHGIPIPVLRAYDDQGPITLVHIDAHLDWRDHVNGARGGYSSPIRRAAEMDH
VGQIFQIGLRSAGSARPEEVEAAQAYGAVLIPDVELQDVGMKAVLDRIPDGGRYYLTIDA
DGMDPTIMPAVNGPAPGGVTYPQIRTLIHGLVKKGRVVGMDIVEITPKKDVNGITAITAG
RIICNLIGKTIQAGYFDAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccctgaccaacccgccgcgccgcgaactgcagagcttcctcgacttcccc
atctgcacggatctcgaccagctcgacggccacatcggcatcctcggcatcccctacggc
gatccctactcgatcgacgaggtgaccaacgaccagaccaacgccccgacctgggtccgc
cgctacaccgagcgggcgctgcgccagctggagcgctgggacttcgacatcggcggtccg
ctgctcggcgggaaggacatcaaggtcgtggactgcggcgacgtgaaggcgaacccgcgc
gacctcgacctgcattaccgcaacgccgaggcggtggtgcgggcgatgctcgccaagggc
atgctccccatcatcatcggcggtgaccacggcatcccgatcccggtgctgcgcgcctac
gacgaccagggcccgatcacgctcgtgcacatcgacgcgcacctcgactggcgcgaccat
gtgaacggcgcccgcggcggctattccagcccgatccgccgcgccgcggagatggaccat
gtcggccagatcttccagatcggcctgcgctccgccggcagcgcccggccggaggaggtc
gaagcggcccaggcctacggcgccgtgctgatccccgacgtggagttgcaggacgtcggc
atgaaggcggtgctcgaccgcattcccgacggcgggcgctactacctgaccatcgacgcc
gacggcatggacccgaccatcatgccggccgtcaacggcccggcgccgggcggcgtgacc
tatccccagatccgcacgctgatccacggtctggtgaagaagggccgcgtggtcggcatg
gacatcgtggagatcacgcccaagaaggacgtgaacggcatcaccgccatcaccgccggc
cgcatcatctgcaacctgatcggcaagaccatccaggccggctacttcgacgccaagtga

DBGET integrated database retrieval system