KEGG   Azospirillum brasilense: AZOBR_p440032Help
Entry
AZOBR_p440032     CDS       T02152                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abs  Azospirillum brasilense
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:abs02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:abs02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:238853..239851
Genome map
AA seq 332 aa AA seqDB search
MTDGPLIVIGASAGGLEALEALVRDLPPDLPAAVCIVLHIGDRPTAAPSILDRAGPLPAS
HARDREPLRAGHIHVAPPGCHLVVEAPRCLRLLRGPREHSTRPAVDPLFRSAARACGPAV
IGVVLSGALNDGTAGLAEIKRRGGVAVVQDPTDARYPGMPRSALDHVAVDHCVPAAAMGA
LLGRLAAERDADAAPPAASKEAPMEGMYNLNRPAALTCPDCGGALRETKVDTLPYFTCHI
GHRYGADSMEEAQLHMVEQAFEVALRALNERAALCLRLAETAQGMGQGLSAKRWDEAGRE
ARERAELLIRFLGEEWIRPPFHPGSGGAPDRF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggatggccccctgatcgtgatcggcgcgtcggcgggcgggctggaggcgctggaa
gccctggtccgggacctgccgcccgatctgccggcggcggtgtgcatcgtcctgcacatc
ggcgaccggcccaccgcggcgccgtcgatcctcgaccgggccgggccgcttccggccagc
cacgcccgcgaccgggagccgctccgcgccggccacatccatgtggcgccgccgggttgc
catctggtggtggaagcgccccggtgcctgcgcctgttgcgcgggccgcgcgagcacagc
acccggcctgccgtcgatccgctgttccggtccgccgcgcgggcttgcggaccggcggtc
atcggcgtggtgctgtcgggggcgttgaacgacggcacggcgggccttgccgaaatcaag
cggcggggcggcgtcgccgtggtgcaggaccccacggacgcgcggtatcccggcatgccg
cgcagcgcgctcgaccacgtcgcggtcgatcactgcgtgccggcggcggccatgggtgcg
ctgctcggccggctggccgcggaacgcgatgcggacgccgcaccgcccgcggcatccaag
gaggcgcctatggaaggcatgtacaatttgaacaggccggccgccctgacctgcccggat
tgcggaggggcgctccgggagaccaaggtggacacgctgccctacttcacctgccacatc
ggccaccgctacggcgccgacagcatggaggaggcgcagcttcacatggttgagcaggcg
ttcgaggtggcgttgcgggccttgaacgaacgcgccgccctgtgcctgcgccttgccgag
acggcgcagggcatggggcaggggctgtccgccaagcggtgggacgaggccgggcgcgag
gcgcgcgagcgcgcggagttgttgatccgcttcctgggcgaggagtggattcgcccacct
ttccaccccggaagcggcggcgcgcccgaccggttctga

DBGET integrated database retrieval system