KEGG   Azospirillum brasilense: AZOBR_p440056Help
Entry
AZOBR_p440056     CDS       T02152                                 

Gene name
AGMAT
Definition
Agmatinase, mitochondrial
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abs  Azospirillum brasilense
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZOBR_p440056 (AGMAT)
Enzymes [BR:abs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AZOBR_p440056 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:complement(265114..266169)
Genome map
AA seq 351 aa AA seqDB search
MIDPQKLDRLRTKYSGSGGDDFHDPEFQRVAALQFSGGKRVQPFAGVSTLLDAPYRPDAA
DAADFGGLDIALIGVPMDLGVTNRAGARLGPRAVRGMERIGPYEHALRMVPAASCKLADV
GDVPLSSRFSLEACHGDILAFYNRVMDAGVVPLSVGGDHSITYSILKALGRERPVGMIHF
DAHCDTGGPYEGAKFHHGGPFRQAVLDGVLDPERTVQIGIRGSTEYLWEFSYDSGMTVIH
AEDIPERGIASVIETARKVVGDGPVYVSFDVDCLDPVFAPGTGTPEVGGLTTREALAILR
GLDGLDIIGGDVVEVAPQYDATTNTAHAGAQMLFEILCLSVRALANRQGRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccctcagaagcttgatcgtttgcgtacgaagtacagcggctccggcggcgac
gacttccacgatccggagttccagcgggtggccgccctccagttctccggcggcaagcgg
gtgcagcccttcgccggggtgtccaccctgctcgacgccccctaccgccccgacgcggcc
gacgccgcggacttcggcgggctggacatcgcgctgatcggcgtgccgatggacctgggc
gtcaccaaccgggccggcgcccgcctcggcccgcgcgccgtgcgcgggatggagcgcatc
ggcccctacgagcacgccctgcgcatggtcccggcggcctcatgcaagctcgccgacgtg
ggcgacgtgccgctgtccagccgcttcagcctggaggcctgccacggcgacatcctggcc
ttctacaaccgcgtgatggacgccggcgtcgtcccgctgtcggtgggcggcgaccattcc
atcacctattcgatcctcaaggcgctgggccgcgagcgcccggtgggcatgatccatttc
gacgcccattgcgacaccggcggcccctacgagggcgccaagttccaccatggcggcccc
ttccggcaggcggttctggacggcgtgctggacccggaacgcacggtgcagatcggcatc
cgcggcagcaccgaatatctgtgggagttctcctacgacagcggcatgaccgtgatccac
gcggaggacatcccggagcgcggcatcgccagcgtcatcgagacggcgcgcaaggtggtg
ggcgacgggccggtctacgtctccttcgacgtggattgcctggacccggtcttcgccccc
ggcaccggcaccccggaggtcggcggcctgaccacacgggaggcgctggcgatcctgcgc
gggctcgacgggctggacatcatcggcggcgacgtggtggaggtggcaccccagtacgac
gcgacgaccaacaccgcccacgccggcgcgcagatgctgttcgagatcctttgcctgtcg
gtgcgcgccctcgccaaccgccaaggccgaggctga

DBGET integrated database retrieval system