KEGG   Azospirillum brasilense: AZOBR_p440128Help
Entry
AZOBR_p440128     CDS       T02152                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abs  Azospirillum brasilense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZOBR_p440128 (galU)
   00052 Galactose metabolism
    AZOBR_p440128 (galU)
   00500 Starch and sucrose metabolism
    AZOBR_p440128 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOBR_p440128 (galU)
Enzymes [BR:abs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZOBR_p440128 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:complement(337229..338098)
Genome map
AA seq 289 aa AA seqDB search
MRKPVRKVVFPVAGLGTRFLPATKAIPKEMLPLVDRPLLQHAVEEARAAGIEDFVFVTGR
SKRAIEDHFDTDTELNRTLEERGKQDALEVVRDSEIAPGRCFYTRQQVPLGLGHAVWCAR
AVIGNDPFAIVLPDDFVQGDTPCLKQMVEAYNEVGGNIVAVVDVPRERTSSYGILDVEKD
DGRLATVRGLVEKPKPEEAPSTLSIIGRYILQPEVFDHLEKQQRGAGNEIQLTDAMAKLI
GTQPFHGLRFEGTRYDCGDKVGFIEATLAHALRRPDMADKVRDMLRKYC
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcctgtgcgcaaggtggtgttccccgtcgccggtctcggtacgcgctttctg
ccggccaccaaggcgattccgaaggaaatgctgcctttggtcgaccggcctctgcttcag
catgccgtggaggaggcgcgggccgccggcatcgaggatttcgtgttcgtcaccggccgc
agcaagcgcgccatcgaagaccatttcgacaccgacacggaactgaaccgcacccttgag
gagcgcggcaagcaggacgccctcgaggtggtgcgcgacagcgagatcgcgccgggccgc
tgcttctacacgcgtcagcaggtcccgctgggcctcggtcacgcggtgtggtgcgcgcgg
gcggtgatcggcaacgaccccttcgccatcgtcctgcccgacgacttcgtccagggcgac
accccctgcctgaagcagatggtggaggcctacaacgaggtgggcggcaacatcgtcgcc
gtggtggacgtcccgcgcgagcggaccagcagctacggcatcctggacgtggagaaggac
gacggccgtctggccaccgtgcgcggcctcgtcgagaagccgaagccggaagaggcgccc
tccaccctgtcgatcatcggccgctacatcctgcagccggaggtgttcgaccatctggag
aagcagcagcgtggcgccggcaacgagatccagctcaccgacgcgatggccaagctgatc
ggcacgcagccgttccacggcctgcgcttcgaaggcacacgctacgactgcggcgacaag
gtcggcttcatcgaagccacgctggcccacgcgctgcgccgtccggacatggcggacaag
gtccgcgacatgctgcgcaagtactgctga

DBGET integrated database retrieval system