KEGG   Azospirillum brasilense: AZOBR_p440169Help
Entry
AZOBR_p440169     CDS       T02152                                 

Gene name
galM
Definition
aldose 1-epimerase (Galactose mutarotase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abs  Azospirillum brasilense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p440169 (galM)
   00052 Galactose metabolism
    AZOBR_p440169 (galM)
Enzymes [BR:abs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AZOBR_p440169 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:381579..382652
Genome map
AA seq 357 aa AA seqDB search
MTPYADLRREDFRATIDGTPTDLFTLRNRRGMAVRITNYGCKIVQILAPDRDGTLGDVVQ
GYETLERTMAGQPSMGSFIGRYCGRIGGGRFTLDGVEHRTAVNAPPNTLHGGQRGSRFRT
FAARQLDEASLELTYVFEDGEEGFPGTLPVRLVYALDEDNALTIAWTAVAADKATVANFT
DHTFFNLSGDAGSSILDHVATVNGSRYLALDATAVPTGELVEVTGTPLDFRSPAAFGARI
AADHPMLALGKGYDLHYAVDKPEGALGLHARVVHPGSGRVLEVLSTEPGVQVYTGNFLDG
QTPRDLGKGGTLYTRHSAFCLEPSHFPNAVNIPSFPSTALAPGQWYAGRIVYRFGVA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgccttatgccgacctccggcgcgaggatttccgcgccaccatcgacggcacgccg
accgacctgttcaccctgcgcaaccgccggggcatggccgtccgcatcaccaattacggc
tgcaagatcgtccagatcctggcgcccgaccgcgacggcaccctcggcgacgtggtgcag
ggctacgagacgctggagcggaccatggccggccagccctccatgggctccttcatcgga
cgctattgcgggcgcatcggcggtggacgcttcacgctggacggggtggagcaccgcacc
gccgtcaacgcgccgcccaacacgctgcacggcggccagcgcggttcgcgcttccgcacc
ttcgccgcgcggcaactggacgaggcgagcctggaactgacctacgtcttcgaggacggg
gaggagggcttccccggcaccctgcccgtccggctggtctacgcgctggacgaggacaac
gccctgaccatcgcctggaccgccgtggcggcggacaaggcgaccgtggcgaacttcacc
gaccacaccttcttcaacctgtcgggcgacgccggctcctcaatcctcgaccatgtggcg
acggtcaacggcagccgctatctggcgctggacgccaccgccgtccccacgggggagctg
gtggaggtgaccggcacccccctcgacttccgcagccccgccgccttcggcgcgcggatc
gccgccgaccacccgatgctggcgctcggcaagggttacgacttgcattacgcggtggac
aagccggagggcgcgctggggctgcacgcccgcgtcgtccatccgggcagcgggcgggtg
ctggaggtcctctccaccgaacctggtgtgcaggtctacaccggcaatttcctggacggc
cagacgccgcgcgacctgggcaagggcggcacgctctacacccggcacagcgccttctgc
ctggagccgtcgcacttccccaacgccgtcaacataccgtccttcccctccaccgcgctg
gcccccggccaatggtatgcgggccgcatcgtctaccgcttcggcgtcgcctga

DBGET integrated database retrieval system