KEGG   Azospirillum brasilense: AZOBR_p470098Help
Entry
AZOBR_p470098     CDS       T02152                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
abs  Azospirillum brasilense
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AZOBR_p470098 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p470098 (adhE)
   00620 Pyruvate metabolism
    AZOBR_p470098 (adhE)
   00650 Butanoate metabolism
    AZOBR_p470098 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_p470098 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZOBR_p470098 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZOBR_p470098 (adhE)
   00626 Naphthalene degradation
    AZOBR_p470098 (adhE)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZOBR_p470098 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AZOBR_p470098 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p4:complement(601019..603679)
Genome map
AA seq 886 aa AA seqDB search
MPVTTLADLNDLVLRVREAQKVYAGFPQETVDRIFRSAALAAANARIPLAKLAVAETRMG
VMEDKVVKNHFASEYIYNKYKDEKTCGILEEDPEYGIMTIAEPVGLICAIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRARKATCEAARIVLQAAVEAGAPADIIGWIDEPSVDLSNA
VMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPAVIDEFADIKRAVASILMSKTF
DNGVVCASEQSAIVVDAVYDAVRDRFAHHGGHILSGTDADAVRKVLLKNGALNADIVGQS
AGAIAAMAGVSVPANTKVLIAEVEAVTEDEPFAHEKLSPTLALYRARDFMDACDKAAALV
ALGGIGHTSALYTDQDQQPERIRHFGQAMKTARILINTPSSQGGIGDLYNFRLAPSLTLG
CGSWGGNSISENVGPQHLINRKTVAKRAENMLWHKLPKSIYFRRGCLPFALEELRGKKRC
LIVTDRFLFENGHVDETVRILKGLGLAVETFFEVAADPTLAVVRRGLALANAFQPDVILA
LGGGSPMDAAKIMWVMYEAPDVAFEDLALRFMDIRKRIYTFPKLGVKAQFVAVPTTSGTG
SEVTPFAVVTDERTGIKYPIADYELTPNMAIIDANLVMDMPKGLTAAGGIDAVTHALEAY
VSVLANEYTDGQALQALKLLKEHLPSAYANGGKDPKAREQVHSAATLAGIAFANAFLGVC
HSMAHKLGAEFHLPHGVANALLIANVIRYNAADIPTKQTAFSQYDRPKGVARYAEIARHL
GLGGSRDHERVETLVAWVEELKRTLDIPASIQAAGVPEAEFLARLDAIAEAAFDDQCTGA
NPRFPLVAEIRQLLLDSYYGRAYAEGAEREPDAKAERKPVALVRSR
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaccacgcttgcagacctcaacgacctcgtccttcgcgtccgggaggcgcag
aaagtctacgccggcttcccgcaggagaccgtggaccgcatcttccgcagcgccgccctg
gccgcggccaacgcgcgcatcccgctggcgaagctggcggttgccgagacgcgcatgggc
gtgatggaggacaaggtcgtcaagaaccacttcgcctccgaatacatctacaacaagtac
aaggatgagaagacctgcggcatcctcgaggaggacccggaatacggcatcatgacgatc
gccgagccggtgggcctgatctgcgccatcgtgccgacgaccaacccgacctcgaccgcc
atcttcaaggcgctgatcagcctgaagacgcgcaacggcatcgtcttctcgccgcacccc
cgcgcccgcaaggcgacctgcgaggccgcgcggatcgtgctccaggccgcggtggaggcc
ggcgcccccgcggacatcatcggctggatcgacgagccctcggtggatctatcgaacgcg
gtgatgcaccaccccgacatcaacctgatcctggcgaccggcgggccgggcatggtcaag
gcggcctattcctcgggcaagccggccatcggcgtcggcgccggcaacaccccggcggtg
atcgacgagttcgccgacatcaagcgggccgtcgcctcgatcctgatgtccaagaccttc
gacaacggcgtggtctgcgcgtcggagcagtcggccatcgtcgtggacgccgtctatgac
gcggtgcgcgaccgctttgcccaccatggcggccacatcctgtcagggacggacgccgat
gcggtgcgcaaggtgctgctgaagaacggcgcgctgaacgccgacatcgtcggccagtcg
gccggcgccatcgccgccatggccggggtgagcgttcccgcaaacaccaaggtgctgatc
gccgaggtcgaggcggtgaccgaggacgagcccttcgcccacgagaagctgtcgccgacc
ctggcgctctaccgcgcccgcgacttcatggacgcctgcgacaaggcggcggcgctggtc
gcgctgggcggcatcggccacacctccgccctctacaccgaccaggaccagcagccggag
cgcatccgccacttcgggcaggcgatgaagacggcgcgcatcctgatcaacacgccgtcg
tcgcagggcggcatcggcgacctctacaatttccggctggcgccgtcgctgacgctcggc
tgcggttcctggggcggcaactcgatctccgagaatgtcgggccgcagcacctcatcaac
cgcaagaccgtggcgaagcgggccgagaacatgctgtggcacaagctgccgaaatccatc
tacttccgccgcggctgcctgcccttcgcgctggaggagctgcgcggcaagaagcgctgc
ctgatcgtcaccgaccgcttcctgttcgagaacggccacgtcgacgagaccgtgcgcatc
ctcaagggtctgggcctcgcggtggagaccttcttcgaggtcgccgccgaccccactctg
gcggtggtgcggcgcgggctggcgctcgccaacgccttccagccggacgtcatcctggcg
ctgggcggcggctcgccgatggacgcggcgaagatcatgtgggtgatgtacgaggcgccg
gacgtcgccttcgaggatctggccctgcgcttcatggacatccgcaagcgcatctacacc
ttcccgaaactgggcgtgaaggcgcagttcgtcgccgtcccgaccacgtccggcaccggg
tctgaggtgacgcccttcgccgtggtgaccgacgagcgcaccggcatcaagtacccgatc
gcggactatgaactgacgccgaacatggcgatcatcgacgccaatctggtgatggacatg
ccgaagggcctgaccgccgccgggggcatcgacgcggtgacccacgcgctggaggcctac
gtctccgtcctggcgaacgagtacaccgacgggcaggcgctgcaggcgctgaagctgctg
aaggagcatctgccctccgcctacgccaacggcggcaaggaccccaaggcacgggagcag
gtgcacagcgccgccacgctggccggcatcgccttcgccaacgccttcctcggcgtctgc
cattcgatggcacacaagctgggggcggagttccacctgccgcacggcgtcgccaacgcg
ctgctgatcgccaacgtcatccgctacaacgccgccgacatcccgaccaagcagaccgcc
ttcagccagtacgaccggcccaagggcgtcgcccgctacgccgagatcgcccgacacctt
ggcctcggcggcagccgcgaccatgagcgggtggagacgctggtggcctgggtggaggag
ttgaagcggacgctggacatcccggcctcgatccaggccgccggggttccggaggcggag
ttcctggcccggttggacgccatcgccgaggccgccttcgacgatcagtgcaccggcgcc
aacccgcgcttcccgctggtcgcggaaatccggcagctcctgctcgacagctactacggc
cgcgcctacgccgagggggcggagcgtgagccggacgccaaggccgagcgcaagccggtg
gcgctggtccgttcgcggtga

DBGET integrated database retrieval system