KEGG   Azospirillum brasilense Sp245: AZOBR_p470098Help
Entry
AZOBR_p470098     CDS       T02152                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
abs  Azospirillum brasilense Sp245
Pathway
abs00010  Glycolysis / Gluconeogenesis
abs00071  Fatty acid degradation
abs00350  Tyrosine metabolism
abs00620  Pyruvate metabolism
abs00625  Chloroalkane and chloroalkene degradation
abs00626  Naphthalene degradation
abs00650  Butanoate metabolism
abs01100  Metabolic pathways
abs01110  Biosynthesis of secondary metabolites
abs01120  Microbial metabolism in diverse environments
abs01130  Biosynthesis of antibiotics
abs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOBR_p470098 (adhE)
   00620 Pyruvate metabolism
    AZOBR_p470098 (adhE)
   00650 Butanoate metabolism
    AZOBR_p470098 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOBR_p470098 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZOBR_p470098 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZOBR_p470098 (adhE)
   00626 Naphthalene degradation
    AZOBR_p470098 (adhE)
Enzymes [BR:abs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZOBR_p470098 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AZOBR_p470098 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCD03682
UniProt: G8B0H3
Position
AZOBR_p4:complement(601019..603679)
Genome map
AA seq 886 aa AA seqDB search
MPVTTLADLNDLVLRVREAQKVYAGFPQETVDRIFRSAALAAANARIPLAKLAVAETRMG
VMEDKVVKNHFASEYIYNKYKDEKTCGILEEDPEYGIMTIAEPVGLICAIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRARKATCEAARIVLQAAVEAGAPADIIGWIDEPSVDLSNA
VMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPAVIDEFADIKRAVASILMSKTF
DNGVVCASEQSAIVVDAVYDAVRDRFAHHGGHILSGTDADAVRKVLLKNGALNADIVGQS
AGAIAAMAGVSVPANTKVLIAEVEAVTEDEPFAHEKLSPTLALYRARDFMDACDKAAALV
ALGGIGHTSALYTDQDQQPERIRHFGQAMKTARILINTPSSQGGIGDLYNFRLAPSLTLG
CGSWGGNSISENVGPQHLINRKTVAKRAENMLWHKLPKSIYFRRGCLPFALEELRGKKRC
LIVTDRFLFENGHVDETVRILKGLGLAVETFFEVAADPTLAVVRRGLALANAFQPDVILA
LGGGSPMDAAKIMWVMYEAPDVAFEDLALRFMDIRKRIYTFPKLGVKAQFVAVPTTSGTG
SEVTPFAVVTDERTGIKYPIADYELTPNMAIIDANLVMDMPKGLTAAGGIDAVTHALEAY
VSVLANEYTDGQALQALKLLKEHLPSAYANGGKDPKAREQVHSAATLAGIAFANAFLGVC
HSMAHKLGAEFHLPHGVANALLIANVIRYNAADIPTKQTAFSQYDRPKGVARYAEIARHL
GLGGSRDHERVETLVAWVEELKRTLDIPASIQAAGVPEAEFLARLDAIAEAAFDDQCTGA
NPRFPLVAEIRQLLLDSYYGRAYAEGAEREPDAKAERKPVALVRSR
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaccacgcttgcagacctcaacgacctcgtccttcgcgtccgggaggcgcag
aaagtctacgccggcttcccgcaggagaccgtggaccgcatcttccgcagcgccgccctg
gccgcggccaacgcgcgcatcccgctggcgaagctggcggttgccgagacgcgcatgggc
gtgatggaggacaaggtcgtcaagaaccacttcgcctccgaatacatctacaacaagtac
aaggatgagaagacctgcggcatcctcgaggaggacccggaatacggcatcatgacgatc
gccgagccggtgggcctgatctgcgccatcgtgccgacgaccaacccgacctcgaccgcc
atcttcaaggcgctgatcagcctgaagacgcgcaacggcatcgtcttctcgccgcacccc
cgcgcccgcaaggcgacctgcgaggccgcgcggatcgtgctccaggccgcggtggaggcc
ggcgcccccgcggacatcatcggctggatcgacgagccctcggtggatctatcgaacgcg
gtgatgcaccaccccgacatcaacctgatcctggcgaccggcgggccgggcatggtcaag
gcggcctattcctcgggcaagccggccatcggcgtcggcgccggcaacaccccggcggtg
atcgacgagttcgccgacatcaagcgggccgtcgcctcgatcctgatgtccaagaccttc
gacaacggcgtggtctgcgcgtcggagcagtcggccatcgtcgtggacgccgtctatgac
gcggtgcgcgaccgctttgcccaccatggcggccacatcctgtcagggacggacgccgat
gcggtgcgcaaggtgctgctgaagaacggcgcgctgaacgccgacatcgtcggccagtcg
gccggcgccatcgccgccatggccggggtgagcgttcccgcaaacaccaaggtgctgatc
gccgaggtcgaggcggtgaccgaggacgagcccttcgcccacgagaagctgtcgccgacc
ctggcgctctaccgcgcccgcgacttcatggacgcctgcgacaaggcggcggcgctggtc
gcgctgggcggcatcggccacacctccgccctctacaccgaccaggaccagcagccggag
cgcatccgccacttcgggcaggcgatgaagacggcgcgcatcctgatcaacacgccgtcg
tcgcagggcggcatcggcgacctctacaatttccggctggcgccgtcgctgacgctcggc
tgcggttcctggggcggcaactcgatctccgagaatgtcgggccgcagcacctcatcaac
cgcaagaccgtggcgaagcgggccgagaacatgctgtggcacaagctgccgaaatccatc
tacttccgccgcggctgcctgcccttcgcgctggaggagctgcgcggcaagaagcgctgc
ctgatcgtcaccgaccgcttcctgttcgagaacggccacgtcgacgagaccgtgcgcatc
ctcaagggtctgggcctcgcggtggagaccttcttcgaggtcgccgccgaccccactctg
gcggtggtgcggcgcgggctggcgctcgccaacgccttccagccggacgtcatcctggcg
ctgggcggcggctcgccgatggacgcggcgaagatcatgtgggtgatgtacgaggcgccg
gacgtcgccttcgaggatctggccctgcgcttcatggacatccgcaagcgcatctacacc
ttcccgaaactgggcgtgaaggcgcagttcgtcgccgtcccgaccacgtccggcaccggg
tctgaggtgacgcccttcgccgtggtgaccgacgagcgcaccggcatcaagtacccgatc
gcggactatgaactgacgccgaacatggcgatcatcgacgccaatctggtgatggacatg
ccgaagggcctgaccgccgccgggggcatcgacgcggtgacccacgcgctggaggcctac
gtctccgtcctggcgaacgagtacaccgacgggcaggcgctgcaggcgctgaagctgctg
aaggagcatctgccctccgcctacgccaacggcggcaaggaccccaaggcacgggagcag
gtgcacagcgccgccacgctggccggcatcgccttcgccaacgccttcctcggcgtctgc
cattcgatggcacacaagctgggggcggagttccacctgccgcacggcgtcgccaacgcg
ctgctgatcgccaacgtcatccgctacaacgccgccgacatcccgaccaagcagaccgcc
ttcagccagtacgaccggcccaagggcgtcgcccgctacgccgagatcgcccgacacctt
ggcctcggcggcagccgcgaccatgagcgggtggagacgctggtggcctgggtggaggag
ttgaagcggacgctggacatcccggcctcgatccaggccgccggggttccggaggcggag
ttcctggcccggttggacgccatcgccgaggccgccttcgacgatcagtgcaccggcgcc
aacccgcgcttcccgctggtcgcggaaatccggcagctcctgctcgacagctactacggc
cgcgcctacgccgagggggcggagcgtgagccggacgccaaggccgagcgcaagccggtg
gcgctggtccgttcgcggtga

DBGET integrated database retrieval system