KEGG   Azospirillum brasilense: AZOBR_p60004Help
Entry
AZOBR_p60004      CDS       T02152                                 

Gene name
rfbC
Definition
dTDP-4,deoxyrhamnose 3,5 epimerase (fragment)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
abs  Azospirillum brasilense
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AZOBR_p60004 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZOBR_p60004 (rfbC)
Enzymes [BR:abs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AZOBR_p60004 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZOBR_p6:6898..7329
Genome map
AA seq 143 aa AA seqDB search
MERDWVQDNQSLSAMPGTVRGLHYQLEPQAQTKLVRVLRGRILDVALDIRRGSPTFGRHV
AVELSADGLEQLLVPVGFAHGFCTLEPDTIVAYKVDAFYSHECERAILWNDPALGIAWPS
VAGSVVSDKDMVASPLAAAIDLL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttggagcgggactgggttcaggacaaccagtccctgtcggccatgccgggcacggtgcgc
ggcctgcattaccagttggagccgcaggcccagaccaagctggtccgcgtcctgcgcggc
cgcatcctcgacgtcgcgctggacatccgccgcggctccccgaccttcgggcggcatgtg
gcggtggagctgagcgccgacgggctggagcagctgctggttccggtggggttcgcccac
ggtttctgcacgctggaacccgacacgatcgtcgcctacaaggtcgacgccttttattct
cacgagtgcgagcgggcgatcctgtggaacgatcccgcgcttggcatcgcctggccgtcc
gtggccgggtccgtggtctcggacaaggacatggtggcgtcgcccctggccgcggccatc
gacctgctttga

DBGET integrated database retrieval system