KEGG   Arcobacter butzleri ED-1: ABED_0462Help
Entry
ABED_0462         CDS       T01823                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(473558..474043)
Genome map
AA seq 161 aa AA seqDB search
MKKKLSPTLTLFYYSNFPKKFNNSSKKKYCVTIGIGGNIGNTKKIFDKLILCLKKDVRFT
LLMTSPLLKNPPFGFLEQSDFLNGIIRLKTNLCPNAFLKAMQRYEKKFGRKRSFQDAPRT
LDIDIIFFDDKKIDTKNLIIPHKNWANRESVIIPLKHMQNN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaaattgagccctactttaacacttttttattattctaattttcctaaaaaa
ttcaataattcttcaaaaaagaaatattgcgtaacaatcggtattggtggaaatattgga
aatacaaaaaaaatatttgataaattaatcttatgtttaaagaaagatgtaagatttact
ttacttatgacttcaccacttcttaaaaatcctccttttggatttttggaacaaagtgat
tttttaaatggtataattcgcctcaaaacaaatctttgtcctaatgcttttttaaaagca
atgcaaagatatgaaaagaaattcggaagaaagcgatcctttcaagatgcgcctagaacc
ttagatatagatattatattttttgatgataagaaaatagatacaaaaaatcttattatc
cctcacaaaaattgggcaaatagagagtcagtgattattcctttaaaacatatgcaaaac
aactag

DBGET integrated database retrieval system