KEGG   Arcobacter butzleri ED-1: ABED_0489Help
Entry
ABED_0489         CDS       T01823                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABED_0489
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABED_0489
Enzymes [BR:abt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ABED_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504346..505626
Genome map
AA seq 426 aa AA seqDB search
MKLIINDKTYTDNSSEADKNSVFIVSKHNEKYLQNAKENGCIDFLNSSELKNHLDMSSIK
IIGITGTNGKTTTATTIYKILLSLGFKVALQGTRGFFINETQVEDYSLTTPIQLGNFVHI
QKAIQNGCQFFVMEVSSHAIEQNRIEGLTFTLKIHTNITRDHLDYHKTIEEYIRVKNSFL
SDESVKLVNIDDNVMKYNFTNAFTYSLKNLSDYKVSKYEFEHGMKVEFSYKEKTYTFTSM
MMGIFNIYNLIGSIAAVHITTQKSLEDICQTLKNFSCVSGRMEIVSLNPLVIVDFAHTPD
GMDEVLKSFPNKDIICVFGAGGNRDSAKRPLMGEVAKKYSKHIIVTSDNPRFEEPKMIIE
DILAGINDKSNVEVLIDRKEALKKAISLANEKSVILVLGKGDEATQIIGDQKFPFSDKDE
ILKYIN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaatcataaacgataaaacatatacagacaattcaagtgaagctgataagaat
tcagtttttattgtttcaaaacataatgaaaaatatttacaaaatgcgaaagaaaatggt
tgtattgattttttaaactcaagtgagttaaaaaatcatttagatatgagttctataaaa
atcattggaataactggaacaaatggtaaaacaacaactgcaacaacaatttataaaata
cttttaagtttaggttttaaagttgcacttcaaggaactcgtggattttttataaatgaa
actcaagttgaagattattctttgacaactccaattcaacttggaaattttgtacatatt
caaaaagctattcaaaatggttgtcaattttttgttatggaagtaagttctcatgcaata
gaacaaaataggattgaaggtttaacttttactttaaaaattcatacaaatattacaaga
gaccatcttgattatcataaaactattgaagaatatataagagttaaaaattcattttta
agtgatgagtctgtaaagctagtaaatatagatgataatgttatgaaatataattttaca
aatgcttttacatattctttaaaaaatctttctgattataaagtaagtaaatatgagttt
gaacatggcatgaaagtggagttttcatacaaagaaaaaacttatacttttacttctatg
atgatgggaatttttaatatttataatcttataggaagtattgctgctgttcatattaca
acacaaaaatctcttgaagatatttgtcaaacattaaaaaacttttcttgtgttagtgga
cgaatggaaatagttagtttaaatccacttgtaattgtggattttgcacatactcctgat
ggaatggatgaagttttaaaaagttttccaaataaagatattatttgtgtttttggtgca
ggtggaaatagagatagtgcaaaacgaccacttatgggagaagttgcaaaaaaatattca
aaacatattattgtaactagcgataatccaagatttgaagaaccaaaaatgataattgaa
gatattttagctggaataaacgataaatcaaatgttgaagttttaatcgatagaaaagaa
gctttgaaaaaagctatatctttagcaaatgaaaaaagtgttattttagttcttggaaaa
ggtgatgaagcaacgcaaataattggtgatcaaaagtttcctttttcagataaagatgaa
atattaaaatatataaattaa

DBGET integrated database retrieval system