KEGG   Arcobacter butzleri ED-1: ABED_0518Help
Entry
ABED_0518         CDS       T01823                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abt00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541265..541882
Genome map
AA seq 205 aa AA seqDB search
MNDKKGAILIISGPSGCGKSTLLKEVYKNISDYYFSISTTTREPRIGEVNGVDYFFVSKE
EFEEDIKKGNFLEYAKVHDNYYGTSLKPIIKALNEGKLVIFDIDVQGHHLVRKKMNDSVT
SVFITTPSLKVLEERLNNRNSDSLEVIEKRVKNAKKEIEFFDEYDYFIVNDNLESASNEL
VSIANIARAKAKLFDKEKIVSNWLN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataaaaaaggtgcaattttaatcatttcaggaccaagtggttgtggaaaatct
actttattaaaagaagtttataaaaatatttctgattactatttttcaatatcaacaact
acaagagaacctagaattggtgaagtaaatggtgttgattatttttttgtttctaaagaa
gagtttgaagaagatataaaaaagggtaatttcttagaatatgcaaaagttcatgataat
tactatggaacatctttaaaaccaataattaaagctttaaatgaaggtaaattagtaatc
tttgatatagatgttcaagggcatcatttagtaagaaaaaaaatgaatgattctgtgact
tcagtttttattacaactccatcattaaaagttttagaagaaagattaaataatagaaat
agtgatagtttagaagttattgaaaaaagagtaaaaaatgccaaaaaagagattgaattt
tttgatgagtatgattattttatagtaaatgacaacttagaaagtgcttcaaatgagcta
gtttctattgcaaatattgcaagagctaaagccaaactttttgataaagaaaaaatagta
tcaaactggcttaattaa

DBGET integrated database retrieval system