KEGG   Arcobacter butzleri ED-1: ABED_0692Help
Entry
ABED_0692         CDS       T01823                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABED_0692
Enzymes [BR:abt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABED_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717584..718141
Genome map
AA seq 185 aa AA seqDB search
MIVGLIGKIIKKEPTQLNVNVNGVIYEVFVSLNCSSKIVSDDVKLEITHIIREDAQSLYG
FLDSNEKKLFDTVIKINGVGPKVALAICSTFTPTSFAQIVSSNDVSMLKRVPGIGPKGAS
RILVELSGFIIDSNDETSGSSSALEAALALESLGFKKDLVSSVLKTCVSSNTSDLVKEAL
KKLQK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagtaggacttataggaaaaataataaaaaaagagccaacacagttaaatgtaaat
gtaaatggagttatttatgaagttttcgtttcgttgaattgtagttcaaagattgtttct
gatgatgtaaaattggaaataactcatattataagagaagatgcacaaagtttatatggt
tttttggattcaaatgaaaaaaagctttttgatacagttataaaaataaatggagttgga
cctaaagttgcacttgcaatttgttctacttttacaccaacatcatttgcacaaatagta
agctcaaatgatgtttcaatgttaaaaagagttccaggaattggacctaaaggtgctagt
agaattttagtagaattatctggatttattattgattcaaatgatgaaacaagtggttca
tcttcagctttagaagctgccttagctttagaatctttaggatttaaaaaagatttagta
tcaagtgtattaaaaacttgtgttagctcaaatacaagtgatttagtaaaagaagcatta
aaaaaattacaaaaataa

DBGET integrated database retrieval system