KEGG   Arcobacter butzleri ED-1: ABED_0773Help
Entry
ABED_0773         CDS       T01823                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABED_0773
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABED_0773
Enzymes [BR:abt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ABED_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(799961..800752)
Genome map
AA seq 263 aa AA seqDB search
MILDEIIEKTKEDLILRKEKLSFEELEKKLKTINSKPKDVKTFLKSTKKEPIRIIAEVKK
ASPSKGIIKEDFNPLEIALEYSQNGANAISVLTEPHYFKGNLEYLSTIKNSVSTPLLRKD
FIVDKYQIAEALLYGADFILLIAKALNEKELKELYEYARSLDLEVLVEIHDNEDLTKALN
SNATIIGINHRNLGTFEMDMALCDKLIPLIPKDKIIVAESGVSDTEVIKRLHKVGADAFL
IGEHFMRVPSIKDELTKFKNTLN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaattatagaaaaaacaaaagaagatttaattttaagaaaagaaaaa
ctaagttttgaagaactagaaaagaaattaaaaactattaactcaaaaccaaaagatgta
aaaacatttttaaaaagtacaaaaaaagaaccaataagaattattgctgaagtaaaaaaa
gcaagtccaagtaaaggaattataaaagaagattttaatccactagaaattgctttagaa
tatagtcaaaatggagcaaatgcaatttctgttttaacagaaccacactattttaaaggt
aatttagaatatttatctactattaaaaatagtgtttcaactcctcttttaagaaaagat
tttattgtggataaatatcaaatagccgaagctttactttatggagcagattttatttta
cttattgcaaaagctttaaatgaaaaagagttaaaagagttatatgaatatgcaagaagt
ttggatttagaagttttagttgaaattcatgataatgaagatttaacaaaagctctaaat
tcaaatgcaacgattataggaatcaatcatagaaatcttggtactttcgaaatggatatg
gctttatgtgataagttaattcctcttattccaaaagataaaatcatagttgcagaatca
ggagtaagcgatactgaagttataaaaagacttcataaagttggagctgatgcattttta
attggtgaacattttatgagagttccttcaattaaagatgaactaacaaaatttaaaaat
actctaaactaa

DBGET integrated database retrieval system