KEGG   Arcobacter butzleri ED-1: ABED_0784Help
Entry
ABED_0784         CDS       T01823                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:abt00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:abt00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:abt00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808411..809421
Genome map
AA seq 336 aa AA seqDB search
MKKLMFLALCSFSFAVEVDNIYEEAQALENQGKYKEAMLLYKKVANLKVSKEDKYVNDLN
EKQNLEFGSFTTLKREFYQKEIDKTEDKGTNENIKQIVTKDFDIYPYKKNYLLPATYTFN
NIENRENVETTFQVSFEKPIYNNLFGFDETISAAYTQKSFWQVAKNSAPFRESNYEPEIF
VQIPYDKESSLKAYKISAMHSSNGKDGEESRSLNRLYLEGYFQFSDIFVIPRVWYRIPES
KDKDDNPDFEDYYGYGDLTLLYAYKQHTFELLLRDNLKFNENNKGAVEFTWTFPLPEFLH
AKNVYGMFQYFYGYGNSLIDYDREINNVGLGIALSR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcatgtttttagctctttgttcttttagttttgcagttgaagtggataat
atttatgaagaagcgcaagctttagaaaatcaaggaaaatataaagaagctatgctttta
tataaaaaagtagctaatttaaaagtttcaaaagaagataaatatgtaaatgatttaaat
gaaaaacaaaacttagaatttggaagttttacaactttaaaaagagaattttatcaaaaa
gagattgataaaacagaagataaaggtacaaatgaaaatataaaacagatagtgacaaaa
gattttgatatatatccatataaaaagaattatttgcttccagcaacttatacttttaat
aatatagaaaatagagaaaatgtagaaacaacttttcaagtaagttttgaaaaaccaatt
tacaataatctatttggttttgatgagacaataagtgcagcttacactcaaaaatctttt
tggcaagtagcaaagaattctgctccttttagagaatcaaactatgaaccagaaattttt
gtacaaattccttatgataaagagagttctttaaaagcttataaaatatctgctatgcac
tcttcaaatggaaaggatggagaagaatctcgttctttaaatagattatatttagaagga
tatttccaattctcagatatttttgtaattcctagagtttggtatagaattcctgaaagc
aaagataaagatgataatccagattttgaagattattatggatatggtgatttaacttta
ctttacgcttataaacaacacacttttgaactgcttttaagagataatttaaaattcaat
gaaaataataaaggtgcagttgaatttacttggacttttcctcttccagagtttttacat
gctaaaaatgtttatgggatgtttcaatatttttatggatatggaaatagtttaattgat
tatgatagagaaataaataatgtaggattgggaatagctttatcaagataa

DBGET integrated database retrieval system