KEGG   Arcobacter butzleri ED-1: ABED_0838Help
Entry
ABED_0838         CDS       T01823                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abt  Arcobacter butzleri ED-1
Brite
Enzymes [BR:abt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ABED_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857777..858694
Genome map
AA seq 305 aa AA seqDB search
MIKSIIFLTIGFSFLYSQEPITAIPTKINVDKNKVNLGKELFFDKRLSKDETISCHSCHS
FSHGGADDKRFSLGVEKKVGDINTPTVFNSVFNFAQFWNGRSKNLYEQAIGPITKDNEMG
MNLQELIIKLNNTEYKNKFKKIYQDGITQNNLIDAIVEYEKTLITPNSPFDRYLKGEKDA
ITQEEKRGYIIFKEQGCIACHHGTNVGGNLYARFGVVDKVNSISKGRFEVTKNEDDLYYF
KVASLRNVQFTSPYLHDGRFDNLSDTVKFMANYQLGKSLSEEDIDSIVSFLKSLTGELYD
YQEEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaatctattatatttttaactattggattttcttttttgtattcacaagaacca
attacggcaattcctacaaaaattaatgttgataaaaataaagttaatttagggaaagaa
cttttttttgataaaagattatctaaagatgaaactatttcttgtcattcttgtcattcg
tttagccatggaggggctgatgataaaagattttctttgggagttgaaaagaaagttgga
gatataaatactcctacagtatttaatagtgtatttaattttgcacaattttggaatgga
agatcgaaaaatctttatgaacaagctattggacctattacaaaagataatgaaatggga
atgaatcttcaagagttaattattaaactaaataatacggaatataaaaataaatttaaa
aagatttaccaagatggtattactcaaaataatttaatagatgcaattgttgaatatgaa
aaaactttgattactccaaattctccttttgatagatatttaaaaggagaaaaagatgct
ataacacaggaagaaaaacgaggatatattatatttaaagaacaaggttgtattgcctgt
catcatggtacaaatgtgggtggaaatttatatgctagatttggtgttgtagataaagtt
aattctatttctaaaggaagatttgaagtaacaaagaatgaagatgatttatattatttt
aaagtagcaagtttaagaaatgttcaatttacatcaccatatttgcacgatggaagattt
gataatttatctgacactgtaaaatttatggcaaattatcaattaggtaaatctttaagt
gaagaagatattgatagcatagtttcatttttaaaatctttaactggagaattgtatgat
tatcaagaagaacaatag

DBGET integrated database retrieval system