KEGG   Arcobacter butzleri ED-1: ABED_0981Help
Entry
ABED_0981         CDS       T01823                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abt  Arcobacter butzleri ED-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:abt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:abt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008523..1009617
Genome map
AA seq 364 aa AA seqDB search
MIKRFLILAILFVSNSLFADENYSKAQIEKMIAKMVILGFNGTSVDKNDEIYKNIQSGLG
GVILFDKDPNDKTKIKNIKDKNQLKNLNTQLQAISNQKLLISIDQEGGVVQRLKKDSGFV
DTLSAKDIATNGEDFAKQSYKALAKDLKDVGINLDFAPVVDLSINKNNKVIVTRGRSFGE
SSSEVIKYSSIFVDELRKQNVISVLKHFPGHGSSLADSHLGFVDITKTWNQKELEPYKYF
IKNNDVDMIMTAHVFNENLDKNYPATLSYNINTKLLREDLGYKGVLVTDDLQMSAISKHY
DLKQTLTLAINSGVNMLLFANQLAKPVTLKEIVDTVYLQIQNKQINLQKIIDSNNKIDKL
LKKI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagatttttgattttagctattttatttgtatcaaatagcttatttgcagac
gaaaattattcaaaagcacaaatagaaaaaatgatagcaaagatggttattttaggtttt
aatggtacaagtgtagataaaaatgatgaaatatataaaaatatacaatcaggacttggt
ggtgtaatactatttgataaagacccaaatgataaaacaaaaataaaaaatataaaagat
aaaaatcagttaaaaaatcttaatacacaacttcaagcaatttcaaatcaaaaattgtta
atttctattgatcaagaaggtggagtagtacaaagacttaaaaaagatagtggttttgta
gatactttaagtgcaaaagatattgctacaaatggtgaagattttgctaaacaaagttat
aaagcacttgctaaggatttaaaagatgttggaataaatcttgattttgctccagttgtt
gatttatctataaacaaaaataataaagttatcgtaacaagaggaagaagttttggtgaa
agttcaagtgaagttataaaatactcttcgatttttgttgatgaactaagaaaacaaaat
gtaatttcagttttaaaacactttcctgggcatggttcatctttagctgattctcattta
ggatttgtagatattacaaaaacttggaatcaaaaagagcttgaaccatataaatatttt
ataaaaaataatgatgtagatatgattatgacagctcatgtatttaatgaaaatttagat
aaaaactatcctgcaactttgtcatacaatataaatacaaaactgcttagagaagatttg
ggatataaaggagttcttgtaacagatgatttacaaatgagcgctatttcaaaacattat
gatttaaaacagactttaactttagctataaattctggagttaatatgctactttttgca
aatcagttagcaaaaccagttactctaaaagagattgtagatactgtttatttacaaatt
caaaataaacaaataaatttacaaaagattatagattcaaataataaaatagataagtta
ctaaaaaaaatataa

DBGET integrated database retrieval system