KEGG   Arcobacter butzleri ED-1: ABED_1006Help
Entry
ABED_1006         CDS       T01823                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abt  Arcobacter butzleri ED-1
Brite
Enzymes [BR:abt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABED_1006
Secretion system [BR:abt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABED_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1033312..1034052)
Genome map
AA seq 246 aa AA seqDB search
MFNLTKKIVMILLFIGTFLFAENKELPKNEISKIEQLEIFKKASIKILKAYDAGSLYILT
ISVHGNKDEIYLTKDKKFIISGTVVNVSNEMQVSAPVDLSITKDKEAFVYGNGKDEYVLF
TDPECPFCKKFESYLPEIKDKVKIRVFFYPLDFHENARDLSLYILSQKTTSQKIDALYEF
NIGDNLSKVKNAKYSKSELSKLEKQLNEHIKIATELNIQGTPALFDKNGNSIVWVNMLEK
YGIEVK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctaacaaaaaaaatagttatgattttattatttattggaacatttttattt
gcggaaaataaagaactaccaaaaaatgaaatttctaaaatagaacaattagaaatattt
aaaaaagcaagtataaaaatcttaaaagcttacgatgctggaagtttatatatattaact
atcagtgtacatggaaataaagatgaaatttatctaacaaaagataaaaaatttattatc
tctggtacagttgtaaatgtatcaaatgaaatgcaagtttcagctccagttgatttatca
attacaaaagataaagaagcttttgtttatggaaatggaaaagatgaatatgttctattt
acagatcctgaatgtccattttgtaaaaaatttgagtcatatttaccagaaattaaagac
aaagttaaaattagagtatttttttatcctttagactttcatgaaaatgctcgtgattta
tctttatacattctaagtcaaaaaacaacttcacaaaaaattgatgctctatatgaattt
aatattggtgataacttgagtaaagtaaaaaatgcaaaatactcaaaatcagaactttca
aaacttgaaaaacagttaaatgaacatattaaaattgcaactgaattaaatattcaaggg
actcctgccttatttgataaaaatggtaatagtatagtttgggttaatatgctagaaaaa
tatggaatagaagtaaaatag

DBGET integrated database retrieval system