KEGG   Arcobacter butzleri ED-1: ABED_1107Help
Entry
ABED_1107         CDS       T01823                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABED_1107
Enzymes [BR:abt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABED_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1132637..1133266
Genome map
AA seq 209 aa AA seqDB search
MKKIYLLNEQKHEDVENLEVFQIEYIKSDIDLKKYDALVFTSKNGVKAINSFNQDWKNIP
SYAIAQKTANTIMKLGGVIEFIGNSGHGNDFAYELKNVLKDKKVLYVKALKTVSNLPNIL
KENGISLDEIIAYKTSCKKSNIILEENSIFIFTSPSSVECFFKQYSWKNSYKAIVIGKTT
AEFLPSNINYEISSQTSVEECIKLAKQLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatatttattaaatgaacaaaaacatgaagatgttgagaatttagaagtt
tttcaaatagagtatataaaatcagatattgatttaaaaaaatatgatgctttagttttt
acatcaaaaaatggtgtaaaagcaataaactcttttaatcaagattggaaaaatattcct
tcttatgcaatagctcaaaaaacagcaaatactataatgaaattgggtggagttattgaa
tttataggaaactctggacatggaaatgattttgcttatgaattaaaaaatgttttaaaa
gataaaaaagttttatatgttaaggctttaaaaacggtttcaaatttgccaaatatttta
aaagaaaatggtatttctttagatgaaataatcgcttataaaacttcttgtaaaaaatca
aatattattttagaagaaaattctatatttatattcacttctccttcaagcgttgaatgt
ttttttaaacaatattcgtggaagaattcatataaagctattgttattggaaaaactaca
gctgagtttttaccttcaaatataaattatgaaattagttctcaaacttcagttgaagag
tgtataaagttagctaaacaactctcttaa

DBGET integrated database retrieval system