KEGG   Arcobacter butzleri ED-1: ABED_1117Help
Entry
ABED_1117         CDS       T01823                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:abt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABED_1117
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ABED_1117
Enzymes [BR:abt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ABED_1117
Two-component system [BR:abt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ABED_1117
Bacterial motility proteins [BR:abt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ABED_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144351..1145430
Genome map
AA seq 359 aa AA seqDB search
MYTVLVIDDSASMRSILKDMINSIEDFEVIAVATDAYDAREKIKEYEPDLVTIDINMPKM
DGVTFLRNLMRLHPMPAVVISGESVRGNDIFDDGAIGFIPKPNSGEPMSNFEARIKDTLL
NLTFLLSRYTLKKSPAIKKPTTYKSTHNVDYKVHPDEVIPLRAAKFPGAKIIAIGSSTGG
VESLLRVFKRLPSGLPPIVITQHIPYGFSNSLAHRLNDNSEVEVCEAKDGLTLEKGHAYL
APGNMHLTIEKYGNDFKTRLLDTKKVSQHKPSVDVLFRSVNNAVGGGAMAVMMTGMGDDG
TIAMKELFDNGAYTIAQNEASCVVFGMPMKAIQAGAVKDIVHLDEIADYIIDFSKGKLK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtacacagttttagttatagatgattctgcttcaatgagaagtatacttaaagatatg
ataaattctattgaagattttgaagtaatagctgtagcaactgatgcttacgatgctaga
gaaaaaatcaaagagtacgaaccagatttagtaacaatagatataaatatgcctaaaatg
gatggtgttacattcttaagaaatttaatgcgtcttcatcctatgccagcagttgtaatc
tctggagaaagtgttagaggaaatgatatttttgatgatggagcgataggttttattcct
aaaccaaactctggtgaacctatgtcaaattttgaagctcgaataaaagatactttgtta
aatttaacattccttttaagccgatacactttaaaaaaatcgcctgctatcaaaaaacca
acaacttataaatcaacacataatgttgattataaagtacatcctgatgaagttatacct
cttagagcagcaaaatttccaggagcaaaaataatagcaattggttcatcaacgggtgga
gttgaatctttattaagagtttttaaaagacttcctagtggattacctccaattgttata
actcaacatattccttatggtttttcgaactctttagctcatagattaaatgataattca
gaagttgaagtttgtgaagcaaaagatggattgactttagaaaaaggacatgcatattta
gccccaggaaatatgcacttaacaatcgaaaaatatggaaatgatttcaaaacgagatta
cttgatacaaaaaaagtaagccagcataaaccaagtgttgatgttctttttagatcagtt
aataatgctgttggtggtggagcaatggctgttatgatgacaggtatgggagatgatgga
acaatagccatgaaagaattatttgataatggagcatatacaattgcacaaaatgaagcg
agttgtgtagtatttggtatgcctatgaaagcaatacaagcaggagctgttaaagatata
gttcatttagatgaaattgctgattatattattgatttttcaaagggaaagcttaaatag

DBGET integrated database retrieval system