KEGG   Arcobacter butzleri ED-1: ABED_1207Help
Entry
ABED_1207         CDS       T01823                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
abt  Arcobacter butzleri ED-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABED_1207
DNA repair and recombination proteins [BR:abt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ABED_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1231014..1231586)
Genome map
AA seq 190 aa AA seqDB search
MNKGLEKFYELVEAFESLPTIGKKSALRLAYHIVMNDNYCGIKIAHSIENALKNITKCSR
CGSMSEHEICEFCLDENRDNEKLCIVQSAKDIFVIEDSNQFDGRYFVIEELDQDVLDSLQ
RFILNNEVKTILFAITPSIANDAFILFIEDKLKDFDIKFTKIAQGVPTGVSLENVDILSL
SKAIQSKVEI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggactagaaaaattttatgaacttgttgaagctttcgaatctttaccaaca
ataggtaaaaaatcggcattaaggcttgcttatcatatcgttatgaatgacaattattgt
ggtataaaaattgcgcacagcatagaaaatgctttgaaaaatatcacaaagtgttcaaga
tgtggttctatgagcgagcatgaaatttgcgaattttgcttagatgaaaatagagataac
gaaaaactttgtattgttcaaagtgcaaaagatatttttgtaatagaagattcaaatcaa
tttgatggaagatattttgtaatagaagagttagaccaagatgttttagactctttgcaa
agatttattttaaataatgaagtaaaaactattctttttgcaataactccgtctattgca
aacgatgcttttattttatttattgaagataaattaaaagattttgatataaaatttaca
aaaattgcacaaggtgttccaactggagttagtttagaaaacgtagatattttatcgtta
tcaaaagcaatacaaagcaaagttgagatttaa

DBGET integrated database retrieval system