KEGG   Arcobacter butzleri ED-1: ABED_1234Help
Entry
ABED_1234         CDS       T01823                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABED_1234
Enzymes [BR:abt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ABED_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262800..1263378
Genome map
AA seq 192 aa AA seqDB search
MVDKDTIKLLSDLSFSMFSKNFFGIYHGAISSKLDQYNFMINTSDAIFDKMDEKSFCTLN
MNKQDYRWNIASIESHIHSTIYTNIHEAKYIAFGMPIYTTAYTLLHDKIVFEDFFGKTFF
GELSIYNPGDFSTWYKRNALEITKYLKESEHNLMVIKGVGTYVYDRDVYELVKKIAILEN
SCRLLSIKSSFE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaagatactataaaattactctctgatttatcattttctatgtttagtaag
aacttttttggtatctatcatggtgcaatttcttctaaacttgatcaatataactttatg
ataaatacaagtgatgctatatttgacaaaatggatgaaaaatctttttgtactttaaat
atgaataaacaagattatagatggaatattgctagtatcgaatctcatattcattcgaca
atatatacaaatatccatgaagcaaaatatattgcttttggtatgccaatttatacaaca
gcctatacattacttcatgacaaaatagtatttgaagatttttttggtaaaacttttttt
ggagaattatctatttataatcctggtgatttttcgacttggtataaaagaaatgccctt
gaaattacaaaatatttaaaagaatctgaacataatttaatggttataaaaggtgtagga
acttatgtatatgatagagatgtttatgaactagttaaaaaaatagctattcttgagaat
tcttgtagacttttaagtataaaaagttcttttgaataa

DBGET integrated database retrieval system