KEGG   Arcobacter butzleri ED-1: ABED_1290Help
Entry
ABED_1290         CDS       T01823                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319745..1322072)
Genome map
AA seq 775 aa AA seqDB search
MQEEYKSFKLSGVIKKVLYKNDETKYIIAVLENNQKVCGTYFDTDIEKIVGEEVVLTGNW
TTHKKYGVQFEFDTLELKEAEMFFFLTKIVKGVGKKFASELLEKYSENELIEILNDRPNE
LLNFKGIKDKKLETIVASWHKFKHLRELGSFLGKFGVTSNLITKIYSTFGEVENLIEKIK
QNPYILINIKGIGFKRADEIAKSLGIDPKSEFRIMACLNYTLREFCDNNGNSSIDKFHLY
KLLDESLRFSNQELLYESAISKMLVDEELFVTSENRVALSMLYYAEKRILEFFNRRKDEK
NKKIIASFDEYLVKKQETLGFELSVEQKKAVELINSGEKTLFLIGYAGTGKSTSSRAILE
LLEEIMSYDDIMTIALSGIASQRISDTTGYNSSTIQSLLVKHKEKDFFPYKAILLDEASM
VNSVTFYQIISKIDDDTIFIIVGDDGQLPAIGAGNILADAIKYELAPICKLTKIYRQNEN
QAIAVIANDIRRGEIPSYKEDYEDFRFIDVSIANYYAMKNSVSSNDFADLRGENSEYILN
NILNISSTYIQDYYDFIKKKKISKALTLFQVITPMKGGVLGVDNLNIQLQKLFNHTKGKA
FASKIYEYKLTDKVIHIKNENMKAQTMSMYKSGLTDFLERRVYNGQLGLIIKLDFEEEKC
IVLYPNDDMVVFYDFENVHHLLSLAYCLTIHKTQGMEYDNALIPMSFSHYIMHNTKLLYT
AITRAKKMCFIVGEEEAFKSACKKLEITIRESVINDLLSKKEPKIELSNIEMITI
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagagtataaaagtttcaaattatcaggagttataaaaaaagttttatataaa
aatgatgaaacaaaatacataattgctgttttagaaaataatcaaaaagtttgtggaaca
tattttgatactgatattgaaaaaatagttggtgaagaggttgttttaactggaaattgg
actacacataaaaagtatggtgttcaatttgagtttgatactttagaactaaaagaagca
gaaatgttcttttttcttacaaagattgtaaaaggtgtaggaaaaaaatttgctagcgaa
cttttagaaaaatatagtgaaaatgaactaattgaaattttaaatgatagaccaaatgaa
cttttaaatttcaaaggtataaaagataaaaaactagaaactattgttgcatcttggcat
aagttcaaacatttaagagaacttggttcatttttaggaaaatttggggtaacttcaaac
ttaattacaaaaatatattcaacttttggtgaagttgaaaatttaatagaaaaaatcaaa
caaaatccatatatcttgataaatataaaaggaataggttttaaaagagctgatgaaata
gcaaaatctcttggaattgacccaaaatcagagtttagaataatggcttgtctaaactat
actttaagagagttttgcgataacaacggaaactcttcaatagacaaatttcatctatat
aaacttttagatgaaagtttgagattttcaaatcaagaacttttatatgaatcagcaatt
tcaaaaatgttagtagatgaagagctttttgttacaagtgaaaatagagttgcactttct
atgctttattatgcagaaaaaagaattttagagttttttaatagaagaaaagatgaaaag
aacaaaaaaattattgcttcttttgatgaatatttagttaaaaaacaagaaactttaggg
tttgaacttagtgttgagcaaaaaaaagcagttgaacttataaatagtggagaaaaaact
ctatttttgattggttacgctggtactggaaaatcaacttcaagtagggcgatattagaa
cttcttgaagagataatgagttatgatgatattatgactattgctttaagtggaatagca
agtcaaagaataagtgatacaacaggttataactcttcaactattcaaagtttacttgta
aaacataaagagaaagatttttttccttataaagctattttacttgatgaagcttctatg
gtaaattcagttactttttatcaaattatttcaaaaattgatgatgatactatttttata
atcgttggagatgatggacagcttcctgctattggagctggaaatattttagcagatgca
ataaaatatgaattagcacctatttgtaaacttacaaaaatttatagacaaaatgaaaat
caagcaatagcagttattgcaaatgatataagacgtggtgaaattccttcttataaagaa
gattacgaagattttaggtttattgatgtttcaatagcaaactattatgcaatgaaaaac
tctgtttcatcaaatgattttgcagatttaagaggtgaaaatagcgaatatattttaaat
aatattttaaatatctcttcaacttatatccaagattattatgattttataaaaaagaaa
aaaatatcaaaagctttgactctttttcaagtaattactccaatgaaaggaggagtttta
ggagttgataatctaaatattcaacttcaaaagctttttaatcacacaaaaggaaaagct
tttgcttcaaaaatttatgaatataaacttacagataaagtaattcatataaaaaatgag
aatatgaaagctcaaactatgagtatgtataaaagtggcttaacggattttttagaaaga
agagtttataacggacaattaggtcttataataaaacttgattttgaagaagaaaaatgt
atcgttttatatccaaatgatgatatggtagtattttatgattttgaaaatgttcatcat
cttttatctttggcttactgtttaactattcataaaactcaaggaatggagtatgataat
gcacttattcctatgagtttttctcactatattatgcataatacaaaactactttataca
gcaattacaagagcaaaaaaaatgtgttttattgttggagaagaagaggcttttaaaagt
gcttgtaaaaaactagaaattacaataagagaatcagtaataaatgatttattaagtaaa
aaagagccaaaaattgagttgtcaaatatcgaaatgattactatttaa

DBGET integrated database retrieval system