KEGG   Arcobacter butzleri ED-1: ABED_1374Help
Entry
ABED_1374         CDS       T01823                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABED_1374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABED_1374
   00020 Citrate cycle (TCA cycle)
    ABED_1374
   00620 Pyruvate metabolism
    ABED_1374
Enzymes [BR:abt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABED_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1408483..1410135
Genome map
AA seq 550 aa AA seqDB search
MAKVYDIFIPDLGADKDVDLIDIMVKVGDKVEVEDGLITLETEKASMDVPTTHAGIIKEI
LVKVGDKANSGDLIARVEAQDDSSADEPKVEVATPAKVEEPKEEVVVQTPTQFVKEQTIK
SVVEEVRVPDLGAEKDVDLIDVMIHVGDVIVKDYSIITLETEKASMDVPAPFGGEVIEIF
VEKGQKINSGDLIAKVIKSVVIEDKVPTPTFAANTTPTKVEKVASSTPTIQEVAAISIEK
EDSKVLSKKATKVYASPSVRKIAREFGVDLGFVKGSGEKGRILKDDIRAYVKEQLNKPAS
ASNIGFGFNLPESKEIDFSVFGKVERVELSRVQKVSGPFLHKNYLSMPHVTQFDEADITE
LEEFRKAQNSIAVDFKLSPLVFIIKAVQKALQIHPKFNSSLSSDGQELIMKKYFNIGVAV
DTPNGLLVPVIKDVDKKGFKDIAIELAELSKKARDGKLTSADMSGGCFTISSLGGIGGTY
FTPIINAPEVAILGVSKSSIKPVFDGKEFKPKLILPLSLSYDHKVIDGADGARFTTTLSQ
LLSDIRLLSL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtttatgatatttttattcctgatttaggtgctgataaagatgttgactta
atcgatattatggttaaagttggagataaagtagaagttgaagatggacttataacttta
gaaactgaaaaagcttctatggatgttcctacaactcatgctggaattatcaaagaaatt
ttagtaaaagttggtgataaagcaaatagtggtgatttaatcgctagagttgaagcacaa
gatgactcaagtgctgatgaaccaaaagttgaagttgcaacacctgcgaaagttgaagaa
ccaaaagaagaagttgttgttcaaactccaacacaatttgtaaaagaacaaactataaaa
tctgttgttgaagaagtaagagtacctgatttaggagcagaaaaagatgttgatttaatc
gatgttatgattcatgttggtgatgttatcgtaaaagattatagtatcatcacacttgaa
acagaaaaagcttctatggatgttcctgcaccatttggtggagaagttattgagattttt
gtagaaaaaggacaaaaaatcaatagtggagatttaatagcaaaagttataaaaagtgtt
gttattgaagataaagttccaactcctacatttgctgcaaatacaactcctacaaaagta
gaaaaagtagcaagttcgactcctacaatccaagaagtagcagctattagtattgaaaaa
gaagatagtaaagttctatctaaaaaagctactaaagtttatgcttcaccaagtgtaaga
aaaatagcaagagaatttggtgttgatttaggatttgtaaaaggaagtggtgaaaaagga
agaatcttaaaagatgatattagagcttatgtaaaagaacagttaaataaacctgctagt
gcttcaaatattggttttggatttaacttacctgaatcaaaagagatagacttctctgta
tttggtaaagttgaaagagttgaacttagtcgtgttcaaaaagtttctggaccattttta
cataaaaactatttatctatgcctcacgttacacaatttgatgaagctgatattacagaa
cttgaagagtttagaaaagcacaaaatagtattgcagtagatttcaaactatctccttta
gtatttattataaaagctgttcaaaaagctttacaaattcatccaaaattcaactcaagt
ttaagtagtgacggtcaagagttaattatgaaaaaatactttaatatcggagttgctgtt
gatacaccaaatggtttattagttccagtaatcaaagatgttgataaaaaaggtttcaaa
gatattgctattgaattagctgaactttctaaaaaagcaagagatggaaaattaacaagt
gcagatatgagtggtggatgcttcactatttctagccttggtggaattggtggaacatac
ttcacgccaattataaatgctcctgaagttgcaattttaggtgtttcaaaatcttctatt
aaacctgtatttgatggtaaagaatttaaaccaaaattaattttacctctaagtttatct
tatgatcacaaagtaattgatggtgcagatggtgctagatttactacaactttatcacaa
cttttaagtgatattagattactaagcttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system