KEGG   Arcobacter butzleri ED-1: ABED_1460Help
Entry
ABED_1460         CDS       T01823                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABED_1460
Enzymes [BR:abt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ABED_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504564..1505625
Genome map
AA seq 353 aa AA seqDB search
MSYRTLEEEIKVLELGLPPQEGDGFIGGRLDPKEASLVLVPVPWEATVSFGQGTANAPDA
IRTSSHQLDVENYHYIKPYTAGIAMLETDKSLQKLSNKARKKALKVIESLEDGTTNKKAL
KFVNEASATLNSSVYEKSLEQIKKGKFVAVVGGDHSCPLGLIKALSDSQTESFGILHVDA
HHDLREAYEGFTYSHASIFYNVMKECEKVSNLVQVGIRDYSKEEATRMINYGSKGACLYD
TLMQSELASGKSLEEVFAPYINQLPQNVYLSIDIDGLEPLNCPNTGTPVPGGLRYGELEH
LIFMIVKAGKNIIGFDLCEVGDSADGWDANVGSRVLYQLCGALLASQGKIEYK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatagaactttagaagaagagataaaagtattagaactaggtcttcctccacaa
gaaggtgatggatttatcggtggaagattagatccaaaggaagctagtttagttttagtt
cctgttccttgggaagctactgtttcatttggacaaggaactgcaaatgctcctgatgca
atcagaacttcaagccatcaattagacgtagaaaactaccactatatcaaaccatatact
gctggtattgctatgcttgaaacagataaaagtttacaaaaactaagtaataaagctaga
aaaaaagctctaaaagttattgaatctcttgaagatggaactacaaataaaaaagcttta
aaatttgtaaatgaagcttcagctactctaaactcatcagtttatgaaaaatctcttgaa
caaataaaaaaagggaaatttgtagcagttgttggaggtgatcactcttgtcctcttgga
cttatcaaagctttaagtgatagtcaaactgaatcttttggaattttacacgttgatgct
caccacgatttaagagaggcttatgaaggttttacttactctcatgcttcaattttttat
aatgttatgaaagagtgtgaaaaagtttcaaatctagttcaagttggtattcgtgattat
agtaaagaagaagcaactagaatgattaattatggttcaaaaggtgcctgtttatatgat
actttaatgcaatcagaacttgctagcggaaaatcacttgaagaggtttttgctccttat
ataaatcaacttccacaaaatgtttatttatcaatagatattgatggtttagagccatta
aactgtccaaatacaggaactccagttccaggaggattaagatatggagagcttgagcat
cttatttttatgattgtaaaagctggtaaaaatatcataggatttgacctttgtgaagtt
ggcgatagtgctgatggttgggatgcaaatgttggctcaagagttttataccaattatgt
ggtgcattacttgcaagtcaagggaaaatagaatacaaataa

DBGET integrated database retrieval system