KEGG   Arcobacter butzleri ED-1: ABED_1491Help
Entry
ABED_1491         CDS       T01823                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABED_1491
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABED_1491
Enzymes [BR:abt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ABED_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531213..1531977)
Genome map
AA seq 254 aa AA seqDB search
MKRLVIKVGTAVLTEDNKKLALDRIQNLVKLIAKLKNEKNLEVILVSSGAVGAGYTVLQL
DKKILANKQALAAIGQPKLMKTYQEMFEEYGITAAQMLFIADDFDSRKRSKNAKNVMENL
LKNKILPIINENDVIATEELIGDNDQLAAYITHYFKADMLAILTDIDGYYDKNPREFSDA
KLQKIVNEISQEELEKVPSANSKFATGGIVTKLKAADFLMQKNIPMYLSSGFDLKNAYDF
LVQNNHNSGTIFKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattggttataaaagttggaacagcagttttaacagaagacaataaaaaactt
gcactagatagaattcaaaatcttgtaaaattgattgcaaaattaaaaaatgaaaaaaat
ctagaagttattttagtatcttctggtgctgttggtgctggatatactgtgttacaactt
gataaaaagattcttgcaaataaacaagctcttgcagcaattggtcaaccaaaattgatg
aaaacatatcaagaaatgtttgaagaatatggtataacagctgcacaaatgctttttata
gcagatgattttgattcaagaaaaagatctaaaaatgcaaaaaatgttatggaaaactta
cttaaaaataagatattacctattataaatgaaaatgatgttattgcaactgaagaactt
attggtgacaatgaccaacttgcagcttatataacgcactattttaaagcagatatgtta
gcaattttaactgatattgatggatattatgacaaaaatccaagagagtttagtgatgcg
aaacttcaaaaaattgtaaatgaaatttctcaagaagagttagaaaaagttcctagtgca
aattcaaaatttgcaacaggtggaatagtaacaaaactaaaagctgctgattttttaatg
caaaaaaatattcctatgtatttaagtagtggatttgacttgaaaaatgcttatgatttt
ttagttcaaaataatcataatagtggaacaatttttaaaaaataa

DBGET integrated database retrieval system