KEGG   Arcobacter butzleri ED-1: ABED_1525Help
Entry
ABED_1525         CDS       T01823                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABED_1525
Enzymes [BR:abt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ABED_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1564403..1564975)
Genome map
AA seq 190 aa AA seqDB search
MNKEIDFENAIKNILTYIGEDINREGLLDTPKRVRKAFEFMCSGYNQDPKEIIQKALFTS
TNDEMVVVKDIEFYSFCEHHMLPIIGKAHVAYIPNGKVVGLSKIPRVVDVFARRLQIQEQ
MTEQICEALNEHLRPKGVAVMIDARHMCMEMRGVEKICSTTVTSSLRGLFKSDKKTKDEF
LSIVASSFHK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagagatagattttgaaaatgcaataaaaaatattttaacttatataggagaa
gatataaatagagaaggtttacttgatactccaaaaagagttagaaaagcttttgaattt
atgtgtagtggttataatcaagacccaaaagagattattcaaaaagcactatttacatca
acaaatgatgaaatggttgttgtaaaagatatagagttttactctttttgtgagcatcat
atgttacctattattggaaaagctcatgttgcttatattccaaatggaaaagttgttgga
ctttctaaaattccaagagttgttgatgtttttgcaagaagacttcaaatacaagaacaa
atgacagagcaaatttgtgaagctttaaatgagcatttaagaccaaaaggtgttgctgtt
atgatagatgcaagacatatgtgtatggaaatgcgtggtgttgaaaaaatctgctcaact
acagttacttcatctttaagaggactttttaaatctgataaaaaaacaaaagatgagttt
ttatcaattgtagcttcatcttttcacaaatag

DBGET integrated database retrieval system