KEGG   Arcobacter butzleri ED-1: ABED_1874Help
Entry
ABED_1874         CDS       T01823                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abt  Arcobacter butzleri ED-1
Pathway
abt00260  Glycine, serine and threonine metabolism
abt00750  Vitamin B6 metabolism
abt01100  Metabolic pathways
abt01110  Biosynthesis of secondary metabolites
abt01120  Microbial metabolism in diverse environments
abt01230  Biosynthesis of amino acids
Module
abt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABED_1874
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABED_1874
Enzymes [BR:abt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABED_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF4252
Motif
Other DBs
NCBI-ProteinID: BAK71591
UniProt: A0A0M1UQ06
Position
complement(1948935..1950416)
Genome map
AA seq 493 aa AA seqDB search
MNFIETRGNDGIKPVEVPFSEAILNPSTSFGGLYVPKHLPKLEDNFIQNHVNKSYKELAY
DILKAFEIDIDENEIKKALDLYDNFDDASNPCPVVKVKEDLFVHEQYHGPTRAFKDMALQ
PFGSILSSIAKKRDEKYLILAATSGDTGPAALNTFKNKENIQVVCLYPDGGTSDVQRLQM
VCEDGKNLKVLGIKGNFDDAQNALKNLLASKTFKEELEKDNIKLSAANSVNFGRIIFQII
YHFWSYIQLLKQNEITFGEKIYLVVPSGNFGNVLGAFYAQEMELPIEKLLVASNENNILT
EWINTGIYDIRNKELKLTKSPAMDILKSSNIERVIYSLFGANRTKELMEELNKNNIFKMS
KKETEQLQKYFSAIYSNDTFGAKTIKEFLDIGYLMDPHTATCIKAYNELKEKPLKTVIYS
TAEWTKFSPTVLNALNENSTKYADKEALEEISLKYNATLSQSIKDLFTAKVNHSLVINKE
DIETQIVKFIREL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttatagaaacaagaggaaatgacggaataaaacctgtagaagttccatttagt
gaagctattttaaatccaagtacatcttttggagggctttatgtacctaaacatttgcca
aaattagaagataattttattcaaaatcatgtaaacaaaagttacaaagagctagcttat
gatattttaaaagcttttgaaattgatatcgatgaaaatgaaatcaaaaaagctttagat
ttatatgataattttgatgatgcttcaaatccttgtccagttgtaaaggtaaaagaagat
ttatttgttcatgaacaatatcatggaccaacacgagcatttaaagatatggcattgcaa
ccttttggttcaattttaagctcaattgcaaaaaaaagagatgaaaaataccttattctt
gctgcaacttctggagatacaggaccagctgcattaaatacatttaaaaataaagagaat
attcaagtagtttgcctttatccagatggtggaacttctgatgttcaaagacttcaaatg
gtttgtgaagatggaaaaaacttaaaagttttaggaatcaaaggaaactttgatgatgct
caaaatgctcttaaaaatttacttgcttcaaaaacttttaaagaagagttggaaaaagat
aatattaaattaagtgctgcaaattcagtaaattttggaagaattatatttcaaataatt
tatcacttttggtcatatattcaacttctaaaacaaaatgaaattacatttggtgagaaa
atttatttagttgttccaagtggaaactttggaaatgttttaggagctttttatgcgcaa
gaaatggaacttcctattgaaaaacttttagtagcatcaaatgaaaacaatatcttaact
gagtggataaatacaggaatttatgatattagaaataaagaactaaaacttacaaaatct
ccagcaatggatattttgaaatcttcaaatattgaaagagtaatttattcactttttgga
gcaaatagaacaaaagagttaatggaagagttaaacaaaaataatatatttaaaatgagt
aaaaaagaaacagaacaactacaaaaatatttttctgctatttactcaaatgacactttt
ggagctaagacaattaaagaatttttagatattggatacttaatggatcctcatactgca
acttgtataaaagcatataatgaactaaaagaaaaacctttaaaaactgttatttattca
actgctgaatggacaaaattttcaccaactgtgttaaatgctttaaatgaaaactctaca
aaatatgctgataaagaagctttagaagaaatttcattgaaatataatgcaactttatct
caaagcattaaagatttattcactgcaaaagttaatcattctttagtaataaataaagaa
gatattgaaactcaaatcgtaaaatttattagagaattataa

DBGET integrated database retrieval system