KEGG   Arcobacter butzleri ED-1: ABED_1929Help
Entry
ABED_1929         CDS       T01823                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABED_1929
   01230 Biosynthesis of amino acids
    ABED_1929
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABED_1929
   00051 Fructose and mannose metabolism
    ABED_1929
   00562 Inositol phosphate metabolism
    ABED_1929
Enzymes [BR:abt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABED_1929
Exosome [BR:abt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABED_1929
  Exosomal proteins of bladder cancer cells
   ABED_1929
  Exosomal proteins of melanoma cells
   ABED_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2002373..2003083
Genome map
AA seq 236 aa AA seqDB search
MPIVASNFKTNHTRKSTTLFVNEVNNFLEKNKISNEVYIFPTSTSLDHFQTVPNLMIGVQ
NAYPTTNGSFTGEIGTFQLNEFEIKTILIGHSERRHILGETQETITKKYEFYKNLGYKII
YCIGEPLEIKKQGIEKTLEYIYEQFIGIDVNYSNLILAYEPVWAIGTGVTATIDDIKNVH
NAIKQKINKPLLYGGSVKVENVREICQIENVDGALIGTASWTVEDFIEILENTKDL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagttgcaagtaatttcaaaactaatcatacaagaaaatcaactactttattt
gtaaatgaagtaaataattttttggaaaaaaataaaatttctaatgaagtttatattttt
ccaacatcaacttcattggatcattttcagactgttcctaatcttatgattggagtacaa
aatgcttatccaacgacaaatggctcatttactggagaaataggaacttttcaattaaat
gaatttgaaattaaaacaattttaataggtcatagtgaaagaagacatatcttaggtgaa
actcaagaaacaattacaaaaaaatatgagttttacaaaaatttaggatataaaatcatt
tattgtataggtgaacctttagagataaaaaaacaaggtattgaaaaaactttagaatat
atttatgaacaatttattggaattgatgtaaattactccaatttgatacttgcttacgaa
ccagtttgggctattggtacaggagttactgctacaatagatgatataaagaatgttcat
aatgcaataaaacaaaaaattaataaaccacttttatatggtggtagcgttaaagtagaa
aatgtaagagaaatctgccaaatagaaaatgttgatggtgctttaattggaactgcttca
tggacagttgaagattttatagaaattttagaaaatacaaaggatttataa

DBGET integrated database retrieval system