KEGG   Arcobacter butzleri ED-1: ABED_1930Help
Entry
ABED_1930         CDS       T01823                                 

Definition
enoyl-ACP reductase
Orthology
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:abt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABED_1930
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ABED_1930
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABED_1930
Enzymes [BR:abt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ABED_1930
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ABED_1930
Lipid biosynthesis proteins [BR:abt01004]
 Fatty acid synthase
  Component type
   ABED_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003085..2003906
Genome map
AA seq 273 aa AA seqDB search
MLMKGKKGVILGVANDKSIAYGIAKACAAQGAKIAFTYLNDALKKRVEPIAAEFGSENLV
YPCDVSKPEEIKALKESLEKDLGEIDFIVHSIAFAPKEGLSGRFYDISKEAFDIAMDVSV
YSLIEVTRELKPLLSNNSSILTLSYYGGVKYIPNYNLMGVAKAALEMTTKYLAEDLGKDG
VRVNAISAGPIKTLAAAGIGDFRFMLKWNEAHSPLKKNVSIDEVGNSGMYLLSDLSSAVT
GEIHYVDSGYNIMGMPAVDFSGEKPKIAWNGEK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgaaaggtaaaaaaggtgtaattttaggtgttgcaaatgataagtcaattgct
tacggaatagcaaaagcttgtgcagcacaaggagctaaaatagcttttacatacttaaat
gatgcactaaaaaaaagagttgaaccaattgctgctgaatttggaagtgaaaatttagtt
tatccttgtgatgtttcaaaacctgaagagataaaagcattaaaagagtctttagaaaaa
gatttaggtgagattgattttatcgttcattctattgcttttgctccaaaagaagggtta
agcggaaggttctatgatatttcaaaagaagcatttgatatagctatggatgtttctgtt
tactctttaatagaagttacaagagaattaaaaccacttttatctaataattcatctatt
ttaactctatcttattatggtggagtaaaatacattccaaattataatcttatgggagtt
gcaaaagcggctttagagatgacaacaaaatatcttgcagaagatttaggaaaagatggt
gttagagtaaatgcaattagtgcaggtccaatcaaaactttagcagctgctggaattggt
gatttcagatttatgttaaaatggaatgaagctcattcaccacttaaaaagaatgtttct
atagatgaagtaggaaattcaggaatgtatttacttagtgatttaagtagtgctgtaact
ggtgaaattcattatgttgatagcggatacaatattatgggaatgccagcagttgatttt
tcaggtgaaaaaccaaaaattgcttggaatggagaaaaatag

DBGET integrated database retrieval system