KEGG   Arcobacter butzleri ED-1: ABED_1930Help
Entry
ABED_1930         CDS       T01823                                 

Definition
enoyl-ACP reductase
Orthology
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abt  Arcobacter butzleri ED-1
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:abt01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:abt00061]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:abt00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003085..2003906
Genome map
AA seq 273 aa AA seqDB search
MLMKGKKGVILGVANDKSIAYGIAKACAAQGAKIAFTYLNDALKKRVEPIAAEFGSENLV
YPCDVSKPEEIKALKESLEKDLGEIDFIVHSIAFAPKEGLSGRFYDISKEAFDIAMDVSV
YSLIEVTRELKPLLSNNSSILTLSYYGGVKYIPNYNLMGVAKAALEMTTKYLAEDLGKDG
VRVNAISAGPIKTLAAAGIGDFRFMLKWNEAHSPLKKNVSIDEVGNSGMYLLSDLSSAVT
GEIHYVDSGYNIMGMPAVDFSGEKPKIAWNGEK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgaaaggtaaaaaaggtgtaattttaggtgttgcaaatgataagtcaattgct
tacggaatagcaaaagcttgtgcagcacaaggagctaaaatagcttttacatacttaaat
gatgcactaaaaaaaagagttgaaccaattgctgctgaatttggaagtgaaaatttagtt
tatccttgtgatgtttcaaaacctgaagagataaaagcattaaaagagtctttagaaaaa
gatttaggtgagattgattttatcgttcattctattgcttttgctccaaaagaagggtta
agcggaaggttctatgatatttcaaaagaagcatttgatatagctatggatgtttctgtt
tactctttaatagaagttacaagagaattaaaaccacttttatctaataattcatctatt
ttaactctatcttattatggtggagtaaaatacattccaaattataatcttatgggagtt
gcaaaagcggctttagagatgacaacaaaatatcttgcagaagatttaggaaaagatggt
gttagagtaaatgcaattagtgcaggtccaatcaaaactttagcagctgctggaattggt
gatttcagatttatgttaaaatggaatgaagctcattcaccacttaaaaagaatgtttct
atagatgaagtaggaaattcaggaatgtatttacttagtgatttaagtagtgctgtaact
ggtgaaattcattatgttgatagcggatacaatattatgggaatgccagcagttgatttt
tcaggtgaaaaaccaaaaattgcttggaatggagaaaaatag

DBGET integrated database retrieval system