KEGG   Arcobacter butzleri RM4018: Abu_0384Help
Entry
Abu_0384          CDS       T00600                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00340  Histidine metabolism
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
abu01230  Biosynthesis of amino acids
Module
abu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Abu_0384 (hisD)
Enzymes [BR:abu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Abu_0384 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABV66659
UniProt: A8ERT5
Position
383775..385067
Genome map
AA seq 430 aa AA seqDB search
MKIINTKDANFKAEFESILARAKSDIKGVSSIVSNIIDEIVNEGNVALKRHIEKFDKWEV
KSDEELLISQDDMEKAYLNIDEKLRLALHTAFNRIKAYHEKQLPKSWIDFESNGTILGQK
VTPVDRAGLYIPGGKAAYPSSLLMNAIPALVAGVKEIVVCTPTPNNEVNELLLAACHLCK
VSKVYKVGGASAIAAMAYGTQTISKVDVITGPGNIFVATAKKLVFGEVNIDMIAGPSEIG
ILADETAKPHYLAIDLLSQAEHDEMASSIMITTCDEVANLTSNEVEEYLKTLSRETIARK
SIDERGAIIVASNMEEAIELMNEIAPEHLEVMTKNPFELLPFIKHAGAIFLGENTPEPIG
DYIAGPNHTLPTGSTAKFYSPLNVENFMKKSSIINFSKNAINELGEACAILADTEGLTAH
AKSVRVRLEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattataaatacaaaagatgcaaattttaaagctgaatttgaatcgattttagca
agagcaaaaagcgatataaaaggtgtttcttctattgtttcaaatattattgatgaaatt
gtaaatgaaggaaatgttgctttaaaaagacatattgaaaagtttgataaatgggaagtt
aaaagtgatgaagaacttcttatttcacaagatgatatggaaaaagcatatcttaatatt
gatgaaaaattaagacttgctttacacactgcttttaatagaataaaagcttatcatgaa
aagcaacttccaaaatcatggatagattttgagtcaaatggaacaatcttaggacaaaaa
gtaactccagttgatagagctggactttatattcctggtggaaaagctgcttatccaagt
agtttacttatgaatgcaattccagcattagttgcaggagtaaaagagatagttgtatgt
actccaactccaaataatgaagtaaatgaacttttacttgcagcttgtcacttatgtaaa
gtttcaaaagtttataaagttggaggagcaagtgcaattgctgctatggcttatggaaca
caaactatttcaaaagttgatgtaattacaggacctggaaatatatttgttgcaacagct
aaaaaacttgtatttggtgaagtaaatattgatatgattgcaggtccaagtgagattgga
atacttgcagatgaaacagcgaaacctcactatttagcaattgatttattatctcaagca
gaacacgatgaaatggctagttctattatgattacaacttgtgatgaagttgctaattta
acaagtaatgaagttgaagagtatttaaaaactttaagtagagaaacaattgctagaaaa
tcaattgatgaaagaggagcaataattgttgcttcaaatatggaagaagcaattgaactt
atgaatgaaattgctcctgagcacttagaagttatgacaaaaaatccttttgaattactt
ccatttattaaacatgcaggagcaattttcttaggtgaaaatactcctgaaccaattgga
gattatatagcaggtcctaatcatacacttccaacaggaagtacagctaagttttatagc
ccattaaatgtggaaaattttatgaaaaaaagttctattataaacttttctaaaaatgct
ataaatgagttaggagaagcttgtgctattttagccgacacagaaggtcttacagctcac
gcaaaatctgtaagagttagattagagaaataa

DBGET integrated database retrieval system