KEGG   Arcobacter butzleri RM4018: Abu_0486Help
Entry
Abu_0486          CDS       T00600                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(494480..494965)
Genome map
AA seq 161 aa AA seqDB search
MKKKLSPTLTLFYYSNFPKKFNNSSKKKYCVTIGIGGNIGNTKKIFDKLILCLKKDVRFT
LLMTSPLLKNPPFGFLEQSDFLNGIIRLKTNLCPNAFLKAMQRYEKKFGRKRSFQDAPRT
LDIDIIFFDNKKIDTKNLIIPHKNWANRESVIIPLKHMQNN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaaattgagccctactttaacacttttttattattctaattttcctaaaaaa
ttcaataattcttcaaaaaagaaatattgcgtaacaatcggtattggtggaaatattgga
aacacaaaaaaaatatttgataaattaatcttatgtttaaaaaaagatgtaagatttact
ttacttatgacttcaccacttcttaaaaatcctccttttggatttttggaacaaagtgat
tttttaaatggtataattcgcctcaaaacaaatctttgtcctaatgcttttttaaaagca
atgcaaagatatgaaaagaaattcggaagaaagcgatcctttcaagatgcgcctagaacc
ttagatatagatattatattttttgataataagaaaatagatacaaaaaatcttattatc
cctcacaaaaattgggcaaatagagagtcagtgattattcctttaaaacatatgcaaaac
aactaa

DBGET integrated database retrieval system