KEGG   Arcobacter butzleri RM4018: Abu_0544Help
Entry
Abu_0544          CDS       T00600                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00230  Purine metabolism
abu01100  Metabolic pathways
Module
abu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Abu_0544 (gmk)
Enzymes [BR:abu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Abu_0544 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Rad17 AAA_22 AAA_33 AAA AAA_14 AAA_16 ABC_tran ATPase_2 Viral_helicase1 RNA_helicase MMR_HSR1 NB-ARC AAA_29 RsgA_GTPase NTPase_1 Thymidylate_kin NACHT AAA_23 T2SSE Adeno_IVa2 cobW AAA_17 AAA_5 AAA_11 AAA_30 AAA_28 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ABV66811
UniProt: A8ES87
Position
548216..548833
Genome map
AA seq 205 aa AA seqDB search
MNDKKGAILIISGPSGCGKSTLLKEVYKNISDYYFSISTTTREPRVGEVNGVDYFFVSKE
EFEEDIKNGNFLEYAKVHDNYYGTSLKPIINALNEGKLVIFDIDVQGHHLVRKKMNDSVT
SVFITTPSLKVLEERLNNRNSDSLEVIEKRVKNAKKEIEFFDEYDYFIVNDNLESASNEL
VSIANIARAKAKLFDKEKIVSNWLN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataaaaaaggcgcaattttaatcatttcaggaccaagcggttgtggaaaatct
actttattaaaagaagtttataaaaatatttctgattactatttttcaatttctacaact
acaagggaacctagagttggtgaagtaaatggcgttgattatttttttgtttctaaagaa
gagtttgaagaagatataaaaaatggtaatttcttagaatatgcaaaagttcatgataat
tactatggaacatctttaaaaccaataattaatgctttaaatgaaggtaaattagtaatt
tttgatatagatgttcaaggacatcatttagtaagaaaaaaaatgaatgattctgtaact
tcagtttttattacaactccgtcattaaaagttttagaagaaagattaaataatagaaat
agcgatagtttagaagttattgaaaaaagagtgaaaaacgcaaaaaaagagattgaattt
tttgatgagtatgattattttatagtaaatgacaacttagaaagtgcttcaaatgagcta
gtttctatcgcgaatattgcaagagctaaagccaaactttttgataaagaaaaaatagta
tcaaactggcttaattaa

DBGET integrated database retrieval system