KEGG   Arcobacter butzleri RM4018: Abu_0678Help
Entry
Abu_0678          CDS       T00600                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690221..692119
Genome map
AA seq 632 aa AA seqDB search
MCGIVGFIDKNKNIDTLNDMLKIQSYRGPDDSGVYFDEKSGIHLGHNRLSIQDLTSHGHQ
PFVSDCGNYIIVFNGEVYNFKIIKTELQNLGYNFISNSDTEVILYSYKQWGIDCIHKFIG
MFAFSILDKLNNKLFLVRDRAGVKPLYYYKVGNQFMFSSEIKSFHKHPIFRKEQNLSVLP
CFFQFGYIPAPYTIFKNCFKLEAGHYLEYYIENSEFKIVKYWDVNDFYLEDKFNKNENEI
LEEIEKILDNAIDLRMVSDVPVGVFLSGGYDSSLVASILAKKQGKKINTFTIGFDDKKYN
EAEHAKTIAEYLGTNHTEYYMRNSDMLDLVESLPFYYDEPFGDSSALPTMIVSKLARKSV
TVALSADGGDEAFCGYSKYFFLNKFQNIFSNTLKKELLKIGLNFFNPNILDYINNKLPKN
LKQTNIKDKYIKFQRAINSKSLEEMFQNASSYVDKKEIVKFLKINKNEDLFKKWNKIENI
EFLDQMMAIDYKLFMNDDVLTKVDRATMSVSLEGREPLLDHRIIEYMARVPLDIKYRNKQ
GKYLLRQILYKYLPKEMVDKPKSGFQIPLNEWLRGELKPLVLKYLDDTKLDENIFDIKEI
NILKKRFFEEEDLGTTIWFILIYQMWKEEWLA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagttggatttatagacaaaaataaaaatatagatactctaaatgatatg
cttaaaattcaatcatacagaggtcctgatgatagtggggtttattttgatgaaaaaagt
ggtattcatcttggtcacaatcgtttatctattcaagatttaacttctcatggacatcaa
ccttttgtaagtgattgtggaaattatattatagtatttaatggtgaagtttataatttt
aagattattaaaactgaacttcaaaatttaggttataactttatttctaatagtgataca
gaagttatactttacagttataaacaatggggtatagattgtattcataaatttataggt
atgttcgctttttctatcttagataaactaaataataaactttttttagttagagatagg
gcaggagttaaaccactatattactataaagttggaaatcaatttatgttttcatctgaa
attaaatcttttcataaacatcctatttttagaaaagagcaaaatttaagtgtcttacct
tgtttttttcaatttggatatattcctgctccatatacaatatttaaaaattgttttaaa
cttgaagctggacattatctagaatattatattgagaactctgaatttaaaatagttaag
tattgggatgtaaatgatttttatttagaagataaatttaataaaaatgaaaatgagatt
ttagaagaaatagaaaaaatacttgataatgcaattgatttaagaatggtatctgatgta
cctgttggagtatttttaagcggaggatatgatagttctttagtagcttcaatattggct
aaaaaacaaggtaagaaaatcaatacttttactataggttttgatgataagaaatataat
gaagcagaacatgctaaaactatagctgaatatttaggaacaaatcatactgaatattac
atgagaaatagcgatatgttagatttagttgaaagtttacctttttattatgacgaacca
tttggagacagctcagcattaccaacgatgatagtatcaaaattagctagaaagagtgta
acagtagcgcttagtgcagatggtggagatgaagctttttgtggatatagcaaatacttt
tttttaaataaatttcaaaatattttttcaaatactttaaaaaaagaacttttgaaaatt
ggtttaaatttttttaatccaaatatacttgactatataaataataaattaccaaaaaat
ctaaaacaaacaaatattaaagataaatacataaaatttcaaagagctataaatagtaaa
agtttggaagagatgttccaaaatgcaagtagttatgtggataaaaaagaaatagtaaag
tttttgaaaattaataaaaatgaagatttattcaaaaagtggaataaaatagaaaatatt
gaatttttagatcaaatgatggcaattgattataaactttttatgaatgatgatgtactt
acaaaagtagatcgtgctacaatgagtgttagtttagaaggacgtgaacctttattagat
catagaattattgaatatatggcaagagtaccgttagatataaaatatagaaataagcaa
ggaaaatatctattaagacaaatcctttataagtaccttccaaaagaaatggttgataaa
cctaaatcaggatttcaaatacctctaaatgaatggcttaggggcgagcttaaaccttta
gtattaaaatatttagatgatacaaaacttgatgaaaatatttttgatataaaagaaatt
aatattttgaaaaaaagattttttgaagaagaagatttaggtacaactatttggtttatt
ttaatatatcagatgtggaaggaggaatggcttgcttaa

DBGET integrated database retrieval system